Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane protein
CommentsRv3454, (MTCY13E12.07), len: 422 aa. Probable conserved integral membrane protein, showing some similarity to various proteins (generally transporters) e.g. Q9I5C8|PA0811 probable MFS transporter from Pseudomonas aeruginosa (415 aa), FASTA scores: opt: 145, E(): 0.13, (28.2% identity in 188 aa overlap); Q01266|YHYC_PSESN hypothetical protein in HYUC 3'region (ORF 5) (fragment) from Pseudomonas sp. strain NS671 (245 aa), FASTA scores: opt: 130, E(): 0.75, (24.65% identity in 134 aa overlap); Q9I242|PA2073 probable transporter (membrane subunit) from Pseudomonas aeruginosa (476 aa), FASTA scores: opt: 125, E(): 2.5, (24.6% identity in 252 aa overlap); etc. Equivalent to AAK47900 from Mycobacterium tuberculosis strain CDC1551 (562 aa) but shorter 140 aa. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38748223876090+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3454|Rv3454
MAQGLKLGLHIPLWAGYACSTLIIFPLVVYGMKVLSQLQLWTTPLWLILMAAPFGYLVVSHPDSIGQFFSYAGKDGHGGLSFGSVLLAAGVCLSLIAQIAEQIDYLRFMPPRTPENANRWWTWTLLAGPGWVAFGATKQIIGLFLAVYLMANIPGSSTIANQPVHQFMQIYRTFVPGWLALTLAVILVVLSQIKINVTNAYSGSLAWTNSFTRLTKHYPGRVVFLGVNLAIALILMEANMFDFLNTILGCYANCGMAWVVAVASDIGFNKYLLGLSPKTPEFRRGMLYAINPVGFGSLLLAAGLSIVTFFGGLGAALQPYSPLVAIVTALVMPPILAAATKGKYYLRRTHDGIDLPMYDEHGNPSAAVLTCHVCHQDFERPDMLACQTHGAHVCSLCLSTDKQAEHVLPGLARAHIPGDQVP