Gene Rv3454
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv3454, (MTCY13E12.07), len: 422 aa. Probable conserved integral membrane protein, showing some similarity to various proteins (generally transporters) e.g. Q9I5C8|PA0811 probable MFS transporter from Pseudomonas aeruginosa (415 aa), FASTA scores: opt: 145, E(): 0.13, (28.2% identity in 188 aa overlap); Q01266|YHYC_PSESN hypothetical protein in HYUC 3'region (ORF 5) (fragment) from Pseudomonas sp. strain NS671 (245 aa), FASTA scores: opt: 130, E(): 0.75, (24.65% identity in 134 aa overlap); Q9I242|PA2073 probable transporter (membrane subunit) from Pseudomonas aeruginosa (476 aa), FASTA scores: opt: 125, E(): 2.5, (24.6% identity in 252 aa overlap); etc. Equivalent to AAK47900 from Mycobacterium tuberculosis strain CDC1551 (562 aa) but shorter 140 aa. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3874822 | 3876090 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3454|Rv3454
MAQGLKLGLHIPLWAGYACSTLIIFPLVVYGMKVLSQLQLWTTPLWLILMAAPFGYLVVSHPDSIGQFFSYAGKDGHGGLSFGSVLLAAGVCLSLIAQIAEQIDYLRFMPPRTPENANRWWTWTLLAGPGWVAFGATKQIIGLFLAVYLMANIPGSSTIANQPVHQFMQIYRTFVPGWLALTLAVILVVLSQIKINVTNAYSGSLAWTNSFTRLTKHYPGRVVFLGVNLAIALILMEANMFDFLNTILGCYANCGMAWVVAVASDIGFNKYLLGLSPKTPEFRRGMLYAINPVGFGSLLLAAGLSIVTFFGGLGAALQPYSPLVAIVTALVMPPILAAATKGKYYLRRTHDGIDLPMYDEHGNPSAAVLTCHVCHQDFERPDMLACQTHGAHVCSLCLSTDKQAEHVLPGLARAHIPGDQVP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant