Gene Rv3462c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | No specific function has so far been attributed to this initiation factor; however, it seems to stimulate more or less all the activities of the other two initiation factors, if-2 and if-3. |
| Product | Probable translation initiation factor if-1 InfA |
| Comments | Rv3462c, (MTCY13E12.15c), len: 73 aa. Probable infA, initiation factor if-1, equivalent to P45957|ML1962|INFA translation initiation factor if-1 from Mycobacterium bovis (72 aa) and Mycobacterium leprae (72 aa), FASTA scores: opt: 472, E(): 6.6e-28, (100.0% identity in 72 aa overlap). Also highly similar to others e.g. O54209|IF1_STRCO|INFA|SC6G4.03 from Streptomyces coelicolor (73 aa), FASTA scores: opt: 424, E(): 2e-24, (84.95% identity in 73 aa overlap); O50630|IF1_BACHD|INFA|BH0158 from Bacillus halodurans (71 aa), FASTA scores: opt: 388, E(): 8.1e-22, (77.8% identity in 72 aa overlap); Q9XD14|IF1_LEPIN|INFA from Leptospira interrogans (71 aa), FASTA scores: opt: 376, E(): 6e-21, (80.0% identity in 70 aa overlap); etc. Contains 1 'S1 motif' domain. Belongs to the if-1 family. |
| Functional category | Information pathways |
| Proteomics | Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3880432 | 3880653 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3462c|infA
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Sun R, Converse PJ, Ko C, Tyagi S, Morrison NE and Bishai WR [2004]. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Regulon
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant