Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionNo specific function has so far been attributed to this initiation factor; however, it seems to stimulate more or less all the activities of the other two initiation factors, if-2 and if-3.
ProductProbable translation initiation factor if-1 InfA
CommentsRv3462c, (MTCY13E12.15c), len: 73 aa. Probable infA, initiation factor if-1, equivalent to P45957|ML1962|INFA translation initiation factor if-1 from Mycobacterium bovis (72 aa) and Mycobacterium leprae (72 aa), FASTA scores: opt: 472, E(): 6.6e-28, (100.0% identity in 72 aa overlap). Also highly similar to others e.g. O54209|IF1_STRCO|INFA|SC6G4.03 from Streptomyces coelicolor (73 aa), FASTA scores: opt: 424, E(): 2e-24, (84.95% identity in 73 aa overlap); O50630|IF1_BACHD|INFA|BH0158 from Bacillus halodurans (71 aa), FASTA scores: opt: 388, E(): 8.1e-22, (77.8% identity in 72 aa overlap); Q9XD14|IF1_LEPIN|INFA from Leptospira interrogans (71 aa), FASTA scores: opt: 376, E(): 6e-21, (80.0% identity in 70 aa overlap); etc. Contains 1 'S1 motif' domain. Belongs to the if-1 family.
Functional categoryInformation pathways
ProteomicsIdentified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38804323880653-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3462c|infA
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK
      
Bibliography