Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3472, (MTCY13E12.25), len: 168 aa. Conserved protein, showing some similarity to other proteins e.g. Q9ZAT9|DPSH daunorubicin biosynthesis enzyme from Streptomyces peucetius (194 aa), FASTA scores: opt: 181, E(): 6.8e-05, (30.7% identity in 127 aa overlap); Q53879 DAUH/E from Streptomyces sp. C5 (151 aa), FASTA scores: opt: 168, E(): 0.00038, (29.25% identity in 127 aa overlap); and Q9L4U3|AKNV from Streptomyces galilaeus (144 aa), FASTA scores: opt: 122, E(): 0.36, (31.25% identity in 129 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS38893623889868+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3472|Rv3472
MRPVDEQWIEILRIQALCARYCLTIDTQDGEGWAGCFTEDGAFEFDGWVIRGRPALREYADAHARVVRGRHLTTDLLYEVDGDVATGRSASVVTLATAAGYKILGSGEYQDRLIKQDGQWRIAYRRLRNDRLVSDPSVAVNVADADVAAVVGHLLAAARRLGTQMSDT