Gene Mb3501
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb3501, -, len: 168 aa. Equivalent to Rv3472, len: 168 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 168 aa overlap). Conserved hypothetical protein, showing some similarity to other proteins e.g. Q9ZAT9|DPSH DAUNORUBICIN BIOSYNTHESIS ENZYME from Streptomyces peucetius (194 aa), FASTA scores: opt: 181, E(): 6.8e-05, (30.7% identity in 127 aa overlap); Q53879 DAUH/E from Streptomyces sp. C5 (151 aa), FASTA scores: opt: 168, E(): 0.00038, (29.25% identity in 127 aa overlap); and Q9L4U3|AKNV from Streptomyces galilaeus (144 aa), FASTA scores: opt: 122, E(): 0.36, (31.25% identity in 129 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3837058 | 3837564 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3501|Mb3501 MRPVDEQWIEILRIQALCARYCLTIDTQDGEGWAGCFTEDGAFEFDGWVIRGRPALREYADAHARVVRGRHLTTDLLYEVDGDVATGRSASVVTLATAAGYKILGSGEYQDRLIKQDGQWRIAYRRLRNDRLVSDPSVAVNVADADVAAVVGHLLAAARRLGTQMSDT
Bibliography
No article yet recorded