Gene Rv3482c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved membrane protein |
| Comments | Rv3482c, (MTCY13E12.35c), len: 260 aa. Probable conserved membrane protein. N-terminal region shares some similarity with N-terminus of O88067|SCI35.32c putative membrane protein from Streptomyces coelicolor (319 aa), FASTA scores: opt: 155, E(): 0.023, (54.55% identity in 33 aa overlap); and with C-terminus of O06254|Rv3437|MTCY77.09 hypothetical 17.9 KDA protein from Mycobacterium tuberculosis strain H37Rv (alias AAK47883|MT3542.1 from strain CDC1551) (158 aa), FASTA scores: opt: 140, E(): 0.11, (58.8% identity in 34 aa overlap). Some similarity to others e.g. Q9XAN5|SC4C6.05c putative membrane protein from Streptomyces coelicolor (347 aa), FASTA scores: opt: 131, E(): 0.75, (29.4% identity in 221 aa overlap). First start taken. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3901324 | 3902106 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3482c|Rv3482c
MEHDVATSPPAGWYTDPDGSAGQRYWDGDRWTRHRRPNPSAPRSPLALRVDGLRSRWLGMPAGLRLTVPVAAVLTMVGVAVYAWIRPLPDDWSQLPKRLSCQLRPGPTPPATITVASVDVSHPRGAVLRLVVRFAEPLPPSPSGSFASGFAGYLLTYTIANNGKEFAELGPQQDTDELAIRKPGESRGTEPNMRPDRNTNARRTAPDTVEINLETKRLGLDQAPVDPQLTFAAQFRTPSTVTVDFGSQFCQGERLAGQRR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
