Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3510c, (MTV023.17), len: 278 aa. Conserved protein, similar to Q50662|Rv2303c|MTCY339.06 hypothetical 34.6 KDA protein from Mycobacterium tuberculosis (307 aa), FASTA scores: opt: 416, E(): 1.2e-19, (35.7% identity in 255 aa overlap). Middle of the putative protein highly similar to N-terminal end of Q49860|B229_C2_182 hypothetical 11.0 KDA protein from Mycobacterium leprae (95 aa), FASTA scores: opt: 304, E(): 7.9e-13, (83.65% identity in 55 aa overlap). Also some similarity with other bacterial proteins e.g. P95886 ORF C02006 from Sulfolobus solfataricus (269 aa), FASTA scores: opt: 293, E(): 9.6e-12, (31.3% identity in 198 aa overlap); Q9XDF3|NONC NONC protein from Streptomyces griseus subsp. griseus (317 aa), FASTA scores: opt: 270, E(): 3.4e-10, (29.95% identity in 227 aa overlap); Q54229|NONR macrotetrolide antibiotic-resistance protein from Streptomyces griseus (347 aa), FASTA scores: opt: 270, E(): 3.6e-10, (29.95% identity in 227 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39384213939257-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3510c|Rv3510c
MTIDVWMQHPTQRFLHGDMFASLRRWTGGSIPETDIPIEATVSSMDAGGVTLGLLSAWRGPNGQDLISNDAVAEWVRLYPNRFAGLAAVDLDRPMAAVRELRRRVGEGFVGLRVVPWLWGAPPTDRRYYPLFAECVQSAVPFCTQVGHTGPLRPSETGRPIPYIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVYIDTSAYTIKRLPGKLVRFMKTDTGQRKVLFGTNYPMIAHTHALTGLDELGLSDEARRDFLHGNAVRVFKLDPRGKVQT