Gene Rv3510c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3510c, (MTV023.17), len: 278 aa. Conserved protein, similar to Q50662|Rv2303c|MTCY339.06 hypothetical 34.6 KDA protein from Mycobacterium tuberculosis (307 aa), FASTA scores: opt: 416, E(): 1.2e-19, (35.7% identity in 255 aa overlap). Middle of the putative protein highly similar to N-terminal end of Q49860|B229_C2_182 hypothetical 11.0 KDA protein from Mycobacterium leprae (95 aa), FASTA scores: opt: 304, E(): 7.9e-13, (83.65% identity in 55 aa overlap). Also some similarity with other bacterial proteins e.g. P95886 ORF C02006 from Sulfolobus solfataricus (269 aa), FASTA scores: opt: 293, E(): 9.6e-12, (31.3% identity in 198 aa overlap); Q9XDF3|NONC NONC protein from Streptomyces griseus subsp. griseus (317 aa), FASTA scores: opt: 270, E(): 3.4e-10, (29.95% identity in 227 aa overlap); Q54229|NONR macrotetrolide antibiotic-resistance protein from Streptomyces griseus (347 aa), FASTA scores: opt: 270, E(): 3.6e-10, (29.95% identity in 227 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3938421 | 3939257 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3510c|Rv3510c
MTIDVWMQHPTQRFLHGDMFASLRRWTGGSIPETDIPIEATVSSMDAGGVTLGLLSAWRGPNGQDLISNDAVAEWVRLYPNRFAGLAAVDLDRPMAAVRELRRRVGEGFVGLRVVPWLWGAPPTDRRYYPLFAECVQSAVPFCTQVGHTGPLRPSETGRPIPYIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVYIDTSAYTIKRLPGKLVRFMKTDTGQRKVLFGTNYPMIAHTHALTGLDELGLSDEARRDFLHGNAVRVFKLDPRGKVQT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant