Gene Mb3540c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb3540c, -, len: 278 aa. Equivalent to Rv3510c,len: 278 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 278 aa overlap). Conserved hypothetical protein, similar to Q50662|Rv2303c|MTCY339.06 HYPOTHETICAL 34.6 KDA PROTEIN from Mycobacterium tuberculosis (307 aa), FASTA scores: opt: 416, E(): 1.2e-19, (35.7% identity in 255 aa overlap). Middle of the putative protein highly similar to N-terminal end of Q49860|B229_C2_182 HYPOTHETICAL 11.0 KDA PROTEIN from Mycobacterium leprae (95 aa), FASTA scores: opt: 304, E(): 7.9e-13, (83.65% identity in 55 aa overlap). Also some similarity with other bacterial proteins e.g. P95886 ORF C02006 from Sulfolobus solfataricus (269 aa), FASTA scores: opt: 293, E(): 9.6e-12, (31.3% identity in 198 aa overlap); Q9XDF3|NONC NONC PROTEIN from Streptomyces griseus subsp. griseus (317 aa), FASTA scores: opt: 270,E(): 3.4e-10, (29.95% identity in 227 aa overlap); Q54229|NONR MACROTETROLIDE ANTIBIOTIC-RESISTANCE PROTEIN from Streptomyces griseus (347 aa), FASTA scores: opt: 270, E(): 3.6e-10, (29.95% identity in 227 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3882658 | 3883494 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3540c|Mb3540c
MTIDVWMQHPTQRFLHGDMFASLRRWTGGSIPETDIPIEATVSSMDAGGVTLGLLSAWRGPNGQDLISNDAVAEWVRLYPNRFAGLAAVDLDRPMAAVRELRRRVGEGFVGLRVVPWLWGAPPTDRRYYPLFAECVQSAVPFCTQVGHTGPLRPSETGRPIPYIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVYIDTSAYTIKRLPGKLVRFMKTDTGQRKVLFGTNYPMIAHTHALTGLDELGLSDEARRDFLHGNAVRVFKLDPRGKVQT
Bibliography
No article yet recorded
