Gene Rv3525c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Possible siderophore-binding protein |
| Comments | Rv3525c, (MTCY3C7.31), len: 174 aa. Possible siderophore-binding protein, similar to ferripyochelin binding proteins (and related) e.g. Q9RSN5|DR2089 ferripyochelin-binding protein from Deinococcus radiodurans (240 aa), FASTA scores: opt: 472, E(): 3.3e-21, (46.9% identity in 162 aa overlap); O59257|PH1591 long hypothetical ferripyochelin binding protein from Pyrococcus horikoshii (173 aa), FASTA scores: opt: 431, E(): 6.7e-19, (40.0% identity in 170 aa overlap); Q9V158|FBP|PAB0393 ferripyochelin binding protein from Pyrococcus abyssi (173 aa), FASTA scores: opt: 429, E(): 8.9e-19, (39.4% identity in 170 aa overlap); BAB47820|MLR0180 ferripyochelin binding protein-like from Rhizobium loti (Mesorhizobium loti) (175 aa), FASTA scores: opt: 415, E(): 6.1e-18, (42.55% identity in 141 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3961800 | 3962324 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3525c|Rv3525c
MPLFSFEGRSPRIDPTAFVAPTATLIGDVTIEAGASVWFNAVLRGDYAPVVVREGANVQDGAVLHAPPGIPVDIGPGATVAHLCVIHGVHVGSEALIANHATVLDGAVIGARCMIAAGALVVAGTQIPAGMLVTGAPAKVKGPIEGTGAEMWVNVNPQAYRDLAARHLAGLEPM
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant