Gene Rv3538 (hsd4B)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown; probably involved in cellular metabolism. Predicted to be involved in lipid catabolism. |
| Product | Probable dehydrogenase. Possible 2-enoyl acyl-CoA hydratase. |
| Comments | Rv3538, (MTCY03C7.18c), len: 286 aa. Probable double hotdog R-specific hydratase, substrate unknown, shows structural similarity to six others in Mycobacterium tuberculosis (see Castell et al (2005) below) especially Rv3389. Probable dehydrogenase, similar to Q9L009|SCC30.12c putative dehydrogenase from Streptomyces coelicolor (333 aa), FASTA scores: opt: 842, E(): 3.6e-44, (48.4% identity in 285 aa overlap); and similar to C-terminal part of other (principally estradiol 17 beta-dehydrogenases/17-beta-hydroxysteroid dehydrogenases) e.g. P70540 peroxisomal multifunctional enzyme type II (SDR family) from Rattus norvegicus (Rat) (735 aa) FASTA scores: opt: 622, E(): 1.9e-30, (37.45% identity in 283 aa overlap); or P70523|MPF-2 multifunctional protein 2 (SDR family) (beta-oxidation protein displaying 2-enoyl-CoA hydratase and D-3-hydroxyacyl-CoA dehydrogenase activity) from Rattus norvegicus (Rat) (734 aa), FASTA scores: opt: 616, E(): 4.3e-30, (37.1% identity in 283 aa overlap); P51659|DHB4_HUMAN|HSD17B4|EDH17B4 estradiol 17 beta-dehydrogenase from Homo sapiens (Human) (736 aa), FASTA scores: opt: 614, E(): 5.7e-30, (35.9% identity in 284 aa overlap); P97852|DHB4_RAT|HSD17B4|EDH17B4 estradiol 17 beta-dehydrogenase from Rattus norvegicus (Rat) (735 aa) FASTA scores: opt: 613, E(): 6.6e-30, (37.1% identity in 283 aa overlap); Q9DBM3|HSD17B4 estradiol 17 beta-dehydrogenase from Mus musculus (Mouse) (735 aa) FASTA scores: opt: 611, E(): 8.7e-30, (36.5% identity in 285 aa overlap); etc. Also similar to Q11198|Rv3389c|MTV004.47c hypothetical 30.3 KDA protein from Mycobacterium tuberculosis (290 aa), FASTA scores: opt: 609, E(): 5.3e-30, (39.65% identity in 285 aa overlap). Note that previously known as ufaA2. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays detect expression in M. tuberculosis H37Rv in vivo (in BALB/c and SCID mice) but not in vitro (in 7H9 medium) (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3977062 | 3977922 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3538|Rv3538
MPIDLDVALGAQLPPVEFSWTSTDVQLYQLGLGAGSDPMNPRELSYLADDTPQVLPTFGNVAATFHLTTPPTVQFPGIDIELSKVLHASERVEVPAPLPPSGSARAVTRFTDIWDKGKAAVICSETTATTPDGLLLWTQKRSIYARGEGGFGGKRGPSGSDVAPERAPDLQVAMPILPQQALLYRLCGDRNPLHSDPEFAAAAGFPRPILHGLCTYGMTCKAIVDALLDSDATAVAGYGARFAGVAYPGETLTVNVWKDGRRLVASVVAPTRDNAVVLSGVELVPA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Castell A et al. [2005]. Rv0216, a conserved hypothetical protein from Mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdog fold. Biochemistry
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Van der Geize R et al. [2007]. A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Function Product
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
