Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productprobable dehydrogenase. possible 2-enoyl acyl-coa hydratase.
CommentsMb3568, -, len: 286 aa. Equivalent to Rv3538, len: 286 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 286 aa overlap). Probable dehydrogenase (EC 1.-.-.-), similar to Q9L009|SCC30.12c PUTATIVE DEHYDROGENASE from Streptomyces coelicolor (333 aa), FASTA scores: opt: 842, E(): 3.6e-44, (48.4% identity in 285 aa overlap); and similar to C-terminal part of other (principally ESTRADIOL 17 BETA-DEHYDROGENASES/17-BETA-HYDROXYSTEROID DEHYDROGENASES) e.g. P70540 PEROXISOMAL MULTIFUNCTIONAL ENZYME TYPE II (SDR FAMILY) from Rattus norvegicus (Rat) (735 aa) FASTA scores: opt: 622, E(): 1.9e-30, (37.45% identity in 283 aa overlap); or P70523|MPF-2 MULTIFUNCTIONAL PROTEIN 2 (SDR FAMILY) (beta-oxidation protein displaying 2-enoyl-CoA hydratase and D-3-hydroxyacyl-CoA dehydrogenase activity) from Rattus norvegicus (Rat) (734 aa), FASTA scores: opt: 616, E(): 4.3e-30, (37.1% identity in 283 aa overlap); P51659|DHB4_HUMAN|HSD17B4|EDH17B4 ESTRADIOL 17 BETA-DEHYDROGENASE (EC 1.1.1.62) from Homo sapiens (Human) (736 aa), FASTA scores: opt: 614, E(): 5.7e-30, (35.9% identity in 284 aa overlap); P97852|DHB4_RAT|HSD17B4|EDH17B4 ESTRADIOL 17 BETA-DEHYDROGENASE from Rattus norvegicus (Rat) (735 aa) FASTA scores: opt: 613, E(): 6.6e-30, (37.1% identity in 283 aa overlap); Q9DBM3|HSD17B4 ESTRADIOL 17 BETA-DEHYDROGENASE from Mus musculus (Mouse) (735 aa) FASTA scores: opt: 611, E(): 8.7e-30, (36.5% identity in 285 aa overlap); etc. Also similar to Q11198|Rv3389c|MTV004.47c HYPOTHETICAL 30.3 KDA PROTEIN from Mycobacterium tuberculosis (290 aa), FASTA scores: opt: 609, E(): 5.3e-30, (39.65% identity in 285 aa overlap). Note that previously known as ufaA2.
Functional categoryIntermediary metabolism and respiration
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39202773921137+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3568|Mb3568
MPIDLDVALGAQLPPVEFSWTSTDVQLYQLGLGAGSDPMNPRELSYLADDTPQVLPTFGNVAATFHLTTPPTVQFPGIDIELSKVLHASERVEVPAPLPPSGSARAVTRFTDIWDKGKAAVICSETTATTPDGLLLWTQKRSIYARGEGGFGGKRGPSGSDVAPERAPDLQVAMPILPQQALLYRLCGDRNPLHSDPEFAAAAGFPRPILHGLCTYGMTCKAIVDALLDSDATAVAGYGARFAGVAYPGETLTVNVWKDGRRLVASVVAPTRDNAVVLSGVELVPA
      
Bibliography
No article yet recorded