Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown, but involved in lipid degradation.
ProductProbable acyl-CoA dehydrogenase FadE29
CommentsRv3543c, (MTCY03C7.13), len: 387 aa. Probable fadE29, acyl-CoA dehydrogenase, similar to many e.g. Q9A8P3|CC1310 from Caulobacter crescentus (404 aa), FASTA scores: opt: 624, E(): 9.4e-32, (32.75% identity in 400 aa overlap); Q9I4V2|PA1022 from Pseudomonas aeruginosa (381 aa), FASTA scores: opt: 550, E(): 3.9e-27, (33.7% identity in 350 aa overlap); O28976|AF1293 from Archaeoglobus fulgidus (384 aa), FASTA scores: opt: 529, E(): 8.1e-26, (30.0% identity in 393 aa overlap); etc. Also similar to other from Mycobacterium tuberculosis e.g. O53549|FADE26|Rv3504|MTV023.11 (400 aa), FASTA scores: opt: 1031, E(): 2.8e-57, (46.0% identity in 402 aa overlap). Could belong to the acyl-CoA dehydrogenases family.
Functional categoryLipid metabolism
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
OperonRv3540c, Rv3541c, Rv3542c, Rv3543c, Rv3544c, and Rv3545c are co-transcribed, by RT-PCR (See Chang et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv on cholesterol, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). H37Rv Rv3540c-Rv3545c mutant is attenuated for growth in mouse macrophages and during the early stages of infection in mice (See Chang et al., 2007). M. tuberculosis H37Rv Rv3540c-Rv3545c mutant is unable to grow in minimal medium with cholesterol but can still perform initial steps of cholesterol degradation; in vitro growth defect is partially complemented by having additional mutation in yrbE4a|Rv3501c; reduced CFU of Rv3540c-Rv3545c mutant in C57BL/6 mouse lungs and spleen is complemented by having additional mutation in yrbE4a|Rv3501c (See Chang et al., 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39819773983140-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3543c|fadE29
MFIDLTPEQRQLQAEIRQYFSNLISPDERTEMEKDRHGPAYRAVIRRMGRDGRLGVGWPKEFGGLGFGPIEQQIFVNEAHRADVPLPAVTLQTVGPTLQAHGSELQKKKFLPAILAGEAHFAIGYTEPEAGTDLASLRTTAVRDGDHYIVNGQKVFTTGAHDADYIWLACRTDPNAAKHKGISILIVDTKDPGYSWTPIILADGAHHTNATYYNDVRVPVDMLVGKENDGWRLITTQLNNERVMLGPAGRFASIYDRVHAWASVPGGNGVTPIDHDDVKRALGEIRAIWRINELLNWQVASAGEDINMADAAATKVFGTERVQRAGRLAEEIVGKYGNPAEPDTAELLRWLDAQTKRNLVITFGGGVNEVMREMIAASGLKVPRVPR