Gene Rv3544c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, but involved in lipid degradation. |
| Product | Probable acyl-CoA dehydrogenase FadE28 |
| Comments | Rv3544c, (MTCY03C7.12), len: 339 aa. Probable fadE28, acyl-CoA dehydrogenase, similar to many e.g. Q9RJX3|SCF37.28c from Streptomyces coelicolor (362 aa), FASTA scores: opt: 334, E(): 5.1e-13, (27.65% identity in 329 aa overlap); Q9A5G8|CC2479 from Caulobacter crescentus (344 aa), FASTA scores: opt: 278, E(): 1.2e-09, (26.95% identity in 319 aa overlap); O29813|AF0436 from Archaeoglobus fulgidus (382 aa) FASTA scores: opt: 205, E(): 3.5e-05, (24.75% identity in 384 aa overlap); etc. Also similar to other from Mycobacterium tuberculosis e.g. O53550|FADE27|Rv3505|MTV023.12 (373 aa) FASTA scores: opt: 497, E(): 7e-23, (30.3% identity in 343 aa overlap); and to P46703|ACDP_MYCLE|FADE25|ACD|ML0737|B1308_F1_34 probable acyl-CoA dehydrogenase from Mycobacterium leprae (389 aa) FASTA scores: opt: 165, E(): 0.0012, (25.2% identity in 345 aa overlap). Could belong to the acyl-CoA dehydrogenases family. |
| Functional category | Lipid metabolism |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Operon | Rv3540c, Rv3541c, Rv3542c, Rv3543c, Rv3544c, and Rv3545c are co-transcribed, by RT-PCR (See Chang et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). H37Rv Rv3540c-Rv3545c mutant is attenuated for growth in mouse macrophages and during the early stages of infection in mice (See Chang et al., 2007). M. tuberculosis H37Rv Rv3540c-Rv3545c mutant is unable to grow in minimal medium with cholesterol but can still perform initial steps of cholesterol degradation; in vitro growth defect is partially complemented by having additional mutation in yrbE4a|Rv3501c; reduced CFU of Rv3540c-Rv3545c mutant in C57BL/6 mouse lungs and spleen is complemented by having additional mutation in yrbE4a|Rv3501c (See Chang et al., 2009). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3983125 | 3984144 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3544c|fadE28
MDFDPTAEQQAVADVVTSVLERDISWEALVCGGVTALPVPERLGGDGVGLFEVGALLTEVGRHGAVTPALATLGLGVVPLLELASAEQQDRFLAGVAKGGVLTAALNEPGAALPDRPATSFVGGRLSGTKVGVGYAEQADWMLVTADNAVVVVSPTADGVRMVRTPTSNGSDEYVMTMDGVAVADCDILADVAAHRVNQLALAVMGAYADGLVAGALRLTADYVANRKQFGKPLSTFQTVAAQLAEVYIASRTIDLVAKSVIWRLAEDLDAGDDLGVLGYWVTSQAPPAMQICHHLHGGMGMDVTYPMHRYYSTIKDLTRLLGGPSHRLELLGARCSLT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Rengarajan J et al. [2005]. Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Mutant
- Chang JC et al. [2007]. Identification of Mycobacterial genes that alter growth and pathology in macrophages and in mice. Mutant Operon
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Chang JC et al. [2009]. igr Genes and Mycobacterium tuberculosis cholesterol metabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
