Gene Rv3567c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. Predicted to be involved in lipid catabolism. |
| Product | Possible oxidoreductase. Possible 3-hydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione hydroxylase. |
| Comments | Rv3567c, (MTCY06G11.14c), len: 187 aa. Possible hsaB, oxidoreductase, similar to various oxidoreductases and hypothetical proteins e.g. O69360 ORF61 protein from Rhodococcus erythropolis (194 aa) FASTA scores: opt: 974, E(): 3e-59, (77.05% identity in 183 aa overlap); Q9JN75|MMYF putative oxidoreductase from Streptomyces coelicolor (174 aa), FASTA scores: opt: 451, E(): 1e-23, (43.65% identity in 158 aa overlap); P54990|NTAB_CHEHE|NMOB nitrilotriacetate monooxygenase component B from Chelatobacter heintzii (322 aa), FASTA scores: opt: 409, E(): 1.3e-20, (38.3% identity in 167 aa overlap)Chelatobacter heintzii; AAK62356 putative NADH:FMN oxidoreductase from Burkholderia sp. DBT1 (177 aa), FASTA scores: opt: 360, E(): 1.6e-17, (36.15% identity in 155 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Operon | Rv3568c and Rv3567c, Rv3567c and Rv3566A are co-transcribed in M. bovis BCG, by RT-PCR (See Anderton et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4008719 | 4009282 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3567c|hsaB
MSAQIDPRTFRSVLGQFCTGITVITTVHDDVPVGFACQSFAALSLEPPLVLFCPTKVSRSWQAIEASGRFCVNVLTEKQKDVSARFGSKEPDKFAGIDWRPSELGSPIIEGSLAYIDCTVASVHDGGDHFVVFGAVESLSEVPAVKPRPLLFYRGDYTGIEPEKTTPAHWRDDLEAFLITTTQDTWL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Anderton MC et al. [2006]. Characterization of the putative operon containing arylamine N-acetyltransferase (nat) in Mycobacterium bovis BCG. Operon
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Van der Geize R et al. [2007]. A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Function Product
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
