Gene Mb3598c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible oxidoreductase. possible 3-hydroxy-9,10-seconandrost-1,3,5(10)-triene-9,17-dione hydroxylase. |
| Comments | Mb3598c, -, len: 187 aa. Equivalent to Rv3567c,len: 187 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 187 aa overlap). Possible oxidoreductase (EC 1.-.-.-), similar to various oxidoreductases and hypothetical proteins e.g. O69360 ORF61 PROTEIN from Rhodococcus erythropolis (194 aa) FASTA scores: opt: 974, E(): 3e-59, (77.05% identity in 183 aa overlap); Q9JN75|MMYF PUTATIVE OXIDOREDUCTASE from Streptomyces coelicolor (174 aa), FASTA scores: opt: 451,E(): 1e-23, (43.65% identity in 158 aa overlap); P54990|NTAB_CHEHE|NMOB NITRILOTRIACETATE MONOOXYGENASE COMPONENT B (EC 1.14.13.-) from Chelatobacter heintzii (322 aa), FASTA scores: opt: 409, E(): 1.3e-20, (38.3% identity in 167 aa overlap)Chelatobacter heintzii; AAK62356 PUTATIVE NADH:FMN OXIDOREDUCTASE from Burkholderia sp. DBT1 (177 aa), FASTA scores: opt: 360,E(): 1.6e-17, (36.15% identity in 155 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3951934 | 3952497 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3598c|hsab
MSAQIDPRTFRSVLGQFCTGITVITTVHDDVPVGFACQSFAALSLEPPLVLFCPTKVSRSWQAIEASGRFCVNVLTEKQKDVSARFGSKEPDKFAGIDWRPSELGSPIIEGSLAYIDCTVASVHDGGDHFVVFGAVESLSEVPAVKPRPLLFYRGDYTGIEPEKTTPAHWRDDLEAFLTTTTQDTWL
Bibliography
No article yet recorded
