Gene Rv3571 (hmp)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Predicted to be involved in lipid catabolism |
| Product | Reductase component of 3-ketosteroid-9-alpha-hydroxylase KshB |
| Comments | Rv3571, (MTCY06G11.18), len: 358 aa. kshB, reductase component of 3-ketosteroid-9-alpha-hydroxylase, similar to several e.g. Q44253|ATDA5 aniline dioxygenase reductase component from Acinetobacter sp (336 aa) FASTA scores: opt: 748, E(): 1.5e-38, (34.95% identity in 346 aa overlap); P95533|TDNB electron transfer protein from Pseudomonas putida (337 aa), FASTA scores: opt: 723, E(): 5.2e-37, (36.35% identity in 341 aa overlap); AAK65059|SMA0752 possible dioxygenase reductase subunit from Rhizobium meliloti (Sinorhizobium meliloti) (353 aa) FASTA scores: opt: 495, E(): 4.9e-23, (31.9% identity in 345 aa overlap); P76081|PAAE_ECOLI|B1392 probable phenylacetic acid degradation NADH oxidoreductase (356 aa), FASTA scores: opt: 364, E(): 5.1e-15, (34.45% identity in 357 aa overlap); Q9L131|HMPA flavohemoprotein from Streptomyces coelicolor (398 aa), FASTA scores: opt: 352, E(): 3e-14, (32.8% identity in 247 aa overlap); etc. Contains PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature. Note that it has been shown hmp transcription increased at early stationary phase and is lower at late stationary phase and during exponential growth. Note that previously known as hmp. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by Northern blotting analysis (induction in response to oxygen limitation, nitrosative and oxidative stress) (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv kshB|Rv3571 mutant shows in vitro growth defect with cholesterol, 5-alpha-androstane-3,17-dione, 4-androstene-3,17-dione as carbon source; mutant shows growth defect in BALB/c mice and in resting and activated J774A.1 and BALB/c bone marrow-derived macrophages; SCID mice infected with mutant survive longer than those infected with wild-type; mutant cell wall is altered (See Hu et al., 2010). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4012417 | 4013493 | + |
| promoter | 4012356 | 4012362 | + |
| promoter | 4012380 | 4012385 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3571|kshB
LTEAIGDEPLGDHVLELQIAEVVDETDEARSLVFAVPDGSDDPEIPPRRLRYAPGQFLTLRVPSERTGSVARCYSLCSSPYTDDALAVTVKRTADGYASNWLCDHAQVGMRIHVLAPSGNFVPTTLDADFLLLAAGSGITPIMSICKSALAEGGGQVTLLYANRDDRSVIFGDALRELAAKYPDRLTVLHWLESLQGLPSASALAKLVAPYTDRPVFICGPGPFMQAARDALAALKVPAQQVHIEVFKSLESDPFAAVKVDDSGDEAPATAVVELDGQTHTVSWPRTAKLLDVLLAAGLDAPFSCREGHCGACACTLRAGKVNMGVNDVLEQQDLDEGLILACQSRPESDSVEVTYDE
Bibliography
- Hu Y et al. [1999]. Regulation of hmp gene transcription in Mycobacterium tuberculosis: effects of oxygen limitation and nitrosative and oxidative stress. Regulation Secondary
- Hu Y et al. [1999]. Regulation of hmp gene transcription in Mycobacterium tuberculosis: effects of oxygen limitation and nitrosative and oxidative stress. Secondary Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Kendall SL, Withers M, Soffair CN, Moreland NJ, Gurcha S, Sidders B, Frita R, Ten Bokum A, Besra GS, Lott JS and Stoker NG [2007]. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Regulation
- Van der Geize R et al. [2007]. A gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Function Product
- Capyk JK et al. [2009]. Characterization of 3-ketosteroid 9{alpha}-hydroxylase, a Rieske oxygenase in the cholesterol degradation pathway of Mycobacterium tuberculosis. Biochemistry
- Hu Y et al. [2010]. 3-Ketosteroid 9alpha-hydroxylase is an essential factor in the pathogenesis of Mycobacterium tuberculosis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant