Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPredicted to be involved in lipid catabolism
ProductReductase component of 3-ketosteroid-9-alpha-hydroxylase KshB
CommentsRv3571, (MTCY06G11.18), len: 358 aa. kshB, reductase component of 3-ketosteroid-9-alpha-hydroxylase, similar to several e.g. Q44253|ATDA5 aniline dioxygenase reductase component from Acinetobacter sp (336 aa) FASTA scores: opt: 748, E(): 1.5e-38, (34.95% identity in 346 aa overlap); P95533|TDNB electron transfer protein from Pseudomonas putida (337 aa), FASTA scores: opt: 723, E(): 5.2e-37, (36.35% identity in 341 aa overlap); AAK65059|SMA0752 possible dioxygenase reductase subunit from Rhizobium meliloti (Sinorhizobium meliloti) (353 aa) FASTA scores: opt: 495, E(): 4.9e-23, (31.9% identity in 345 aa overlap); P76081|PAAE_ECOLI|B1392 probable phenylacetic acid degradation NADH oxidoreductase (356 aa), FASTA scores: opt: 364, E(): 5.1e-15, (34.45% identity in 357 aa overlap); Q9L131|HMPA flavohemoprotein from Streptomyces coelicolor (398 aa), FASTA scores: opt: 352, E(): 3e-14, (32.8% identity in 247 aa overlap); etc. Contains PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature. Note that it has been shown hmp transcription increased at early stationary phase and is lower at late stationary phase and during exponential growth. Note that previously known as hmp.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by Northern blotting analysis (induction in response to oxygen limitation, nitrosative and oxidative stress) (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis H37Rv kshB|Rv3571 mutant shows in vitro growth defect with cholesterol, 5-alpha-androstane-3,17-dione, 4-androstene-3,17-dione as carbon source; mutant shows growth defect in BALB/c mice and in resting and activated J774A.1 and BALB/c bone marrow-derived macrophages; SCID mice infected with mutant survive longer than those infected with wild-type; mutant cell wall is altered (See Hu et al., 2010).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40124174013493+
promoter40123564012362+
promoter40123804012385+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3571|kshB
LTEAIGDEPLGDHVLELQIAEVVDETDEARSLVFAVPDGSDDPEIPPRRLRYAPGQFLTLRVPSERTGSVARCYSLCSSPYTDDALAVTVKRTADGYASNWLCDHAQVGMRIHVLAPSGNFVPTTLDADFLLLAAGSGITPIMSICKSALAEGGGQVTLLYANRDDRSVIFGDALRELAAKYPDRLTVLHWLESLQGLPSASALAKLVAPYTDRPVFICGPGPFMQAARDALAALKVPAQQVHIEVFKSLESDPFAAVKVDDSGDEAPATAVVELDGQTHTVSWPRTAKLLDVLLAAGLDAPFSCREGHCGACACTLRAGKVNMGVNDVLEQQDLDEGLILACQSRPESDSVEVTYDE
      
Bibliography