Gene Mb3602
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | reductase component of 3-ketosteroid-9-alpha-hydroxylase kshb |
| Comments | Mb3602, hmp, len: 358 aa. Equivalent to Rv3571,len: 358 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 358 aa overlap). Possible hmp,oxidoreductase, hemoglobine-related protein (see citation below) (EC 1.-.-.-), similar to several e.g. Q44253|ATDA5 ANILINE DIOXYGENASE REDUCTASE COMPONENT from Acinetobacter sp (336 aa) FASTA scores: opt: 748, E(): 1.5e-38, (34.95% identity in 346 aa overlap); P95533|TDNB ELECTRON TRANSFER PROTEIN from Pseudomonas putida (337 aa), FASTA scores: opt: 723, E(): 5.2e-37, (36.35% identity in 341 aa overlap); AAK65059|SMA0752 POSSIBLE DIOXYGENASE REDUCTASE SUBUNIT from Rhizobium meliloti (Sinorhizobium meliloti) (353 aa) FASTA scores: opt: 495, E(): 4.9e-23, (31.9% identity in 345 aa overlap); P76081|PAAE_ECOLI|B1392 PROBABLE PHENYLACETIC ACID DEGRADATION NADH OXIDOREDUCTASE (356 aa), FASTA scores: opt: 364, E(): 5.1e-15, (34.45% identity in 357 aa overlap); Q9L131|HMPA FLAVOHEMOPROTEIN from Streptomyces coelicolor (398 aa), FASTA scores: opt: 352, E(): 3e-14, (32.8% identity in 247 aa overlap); etc. Contains PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature. Note that it has been shown hmp transcription increased at early stationary phase and is lower at late stationary phase and during exponential growth. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3955632 | 3956708 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3602|kshb
MTEAIGDEPLGDHVLELQIAEVVDETDEARSLVFAVPDGSDDPEIPPRRLRYAPGQFLTLRVPSERTGSVARCYSLCSSPYTDDALAVTVKRTADGYASNWLCDHAQVGMRIHVLAPSGNFVPTTLDADFLLLAAGSGITPIMSICKSALAEGGGQVTLLYANRDDRSVIFGDALRELAAKYPDRLTVLHWLESLQGLPSASALAKLVAPYTDRPVFICGPGPFMQAARDALAALKVPAQQVHIEVFKSLESDPFAAVKVDDSGDEAPATAVVELDGQTHTVSWPRTAKLLDVLLAAGLDAPFSCREGHCGACACTLRAGKVNMGVNDVLEQQDLDEGLILACQSRPESDSVEVTYDE
Bibliography
No article yet recorded
