Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis (at the fifth step). Converts 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate into 2C-methyl-D-erythritol 2,4-cyclodiphosphate and CMP. Also converts 4-diphosphocytidyl-2C-methyl-D-erythritol into 2C-methyl-D-erythritol 3,4-cyclophosphate and CMP.
ProductProbable 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF (MECPS)
CommentsRv3581c, (MT3687, MTCY06G11.28c), len: 159 aa. Probable ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, equivalent to Q9CCW5|ML0322 putative 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Mycobacterium leprae (158 aa), FASTA scores: opt: 830, E(): 2.9e-47, (79.1% identity in 158 aa overlap). Also highly similar to others e.g. Q9L0Q7|ISPF_STRCO|SCD8A.07 from Streptomyces coelicolor (170 aa), FASTA scores: opt: 585, E(): 2.9e-31, (56.5% identity in 154 aa overlap); Q9PDT5|ISPF_XYLFA|XF1294 from Xylella fastidiosa (176 aa), FASTA scores: opt: 398, E(): 4.6e-19, (44.9% identity in 156 aa overlap); Q08113|ISDF_RHOCA|ISPDF from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (379 aa), FASTA scores: opt: 387, E(): 4.5e-18, (42.85% identity in 154 aa overlap) (only similar with C-terminal end of this bifunctional protein ISPD and ISPF); Q06756|ISPF_BACSU from Bacillus subtilis (158 aa), FASTA scores: opt: 367, E(): 4.5e-17, (41.2% identity in 153 aa overlap); etc. Belongs to the IspF family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40238684024347-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3581c|ispF
VNQLPRVGLGTDVHPIEPGRPCWLVGLLFPSADGCAGHSDGDVAVHALCDAVLSAAGLGDIGEVFGVDDPRWQGVSGADMLRHVVVLITQHGYRVGNAVVQVIGNRPKIGWRRLEAQAVLSRLLNAPVSVSATTTDGLGLTGRGEGLAAIATALVVSLR