Gene Rv3581c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis (at the fifth step). Converts 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate into 2C-methyl-D-erythritol 2,4-cyclodiphosphate and CMP. Also converts 4-diphosphocytidyl-2C-methyl-D-erythritol into 2C-methyl-D-erythritol 3,4-cyclophosphate and CMP. |
| Product | Probable 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF (MECPS) |
| Comments | Rv3581c, (MT3687, MTCY06G11.28c), len: 159 aa. Probable ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, equivalent to Q9CCW5|ML0322 putative 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Mycobacterium leprae (158 aa), FASTA scores: opt: 830, E(): 2.9e-47, (79.1% identity in 158 aa overlap). Also highly similar to others e.g. Q9L0Q7|ISPF_STRCO|SCD8A.07 from Streptomyces coelicolor (170 aa), FASTA scores: opt: 585, E(): 2.9e-31, (56.5% identity in 154 aa overlap); Q9PDT5|ISPF_XYLFA|XF1294 from Xylella fastidiosa (176 aa), FASTA scores: opt: 398, E(): 4.6e-19, (44.9% identity in 156 aa overlap); Q08113|ISDF_RHOCA|ISPDF from Rhodobacter capsulatus (Rhodopseudomonas capsulata) (379 aa), FASTA scores: opt: 387, E(): 4.5e-18, (42.85% identity in 154 aa overlap) (only similar with C-terminal end of this bifunctional protein ISPD and ISPF); Q06756|ISPF_BACSU from Bacillus subtilis (158 aa), FASTA scores: opt: 367, E(): 4.5e-17, (41.2% identity in 153 aa overlap); etc. Belongs to the IspF family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4023868 | 4024347 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3581c|ispF
VNQLPRVGLGTDVHPIEPGRPCWLVGLLFPSADGCAGHSDGDVAVHALCDAVLSAAGLGDIGEVFGVDDPRWQGVSGADMLRHVVVLITQHGYRVGNAVVQVIGNRPKIGWRRLEAQAVLSRLLNAPVSVSATTTDGLGLTGRGEGLAAIATALVVSLR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
