Gene ML0322
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Involved in the terpenoid biosynthesis pathway (at the fifth step). Converts 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate into 2C-methyl-D-erythritol 2,4-cyclodiphosphate and CMP. Also converts 4-diphosphocytidyl-2C-methyl-D-erythritol into 2C-methyl-D-erythritol 3,4-cyclophosphate and CMP [Catalytic activity: 2-phospho-4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol = 2-C-methyl-D-erythritol 2,4-cyclodiphosphate + CMP]. |
| Product | Probable 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF (MECPS) (MECDP-synthase ) |
| Comments | ML0322, len: 158 aa. Probable ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12), highly similar to Rv3581c|YZ81_MYCTU|P96863 probable ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from M. tuberculosis (159 aa), Fasta scores: E(): 0, (79.1% identity in 158 aa overlap). Similar to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthases, e.g. Escherichia coli 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, BAA95145|AB038256 (159 aa), Fasta scores: E(): 1e-17, (41.3% identity in 155 aa overlap). Contains the PS01350 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase signature and Pfam match to entry PF02542 YgbB, putative enzyme of deoxy-xylulose pathway. Belongs to the IspF family. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 411593 | 412069 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0322|ispF
VSELPRVGLGFDVHVFEPGRPCWLVGLLFPDNDGCAGHSDGDVAVHALCDAVLSAAGQGDIGGLFAVGDPRWERVSGADMLRHVVELLLRHGYEVVNASVQVIGNRPKIGPRRTEAQRLLSALLRAPVSVAATTTEGLGLTGRGEGLSAIATALVVQV
Bibliography
No article yet recorded
