Gene Rv3593
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved lipoprotein LpqF |
| Comments | Rv3593, (MTCY6F7.01c), len: 452 aa. Probable lpqF, conserved lipoprotein, equivalent to Q9CBI7|MPQF|ML1923 probale secreted protein from Mycobacterium leprae (454 aa), FASTA scores: opt: 2465, E(): 5.7e-144, (79.15% identity in 451 aa overlap). Also similar to Q9KJ91 hypothetical 47.1 KDA protein from Streptomyces clavuligerus (430 aa), FASTA scores: opt: 609, E(): 5.2e-30, (30.3% identity in 350 aa overlap); and some similarity with putative beta-lactamases e.g. Q9RYR7|DRA0241 beta lactamase-related protein from Deinococcus radiodurans (499 aa), FASTA scores: opt: 322, E(): 2.5e-12, (28.25% identity in 322 aa overlap). Equivalent to AAK48057 from Mycobacterium tuberculosis strain CDC1551 (438 aa) but longer 14 aa. Contains N-terminal signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
| Proteomics | Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4034352 | 4035710 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3593|lpqF
VGPARLHNRRAGRRMLALSAAAALIVALASGCSSAPTPSANAANHGHRIDTRTPPGLRAQQTMDMLNSDWPIGEIGVGTLAAPGQVDTVKTTMEALWWDRPFALAGVDIGASVAALHLISSYGAQQDIRIHTDDDGWVDRFDVETQAPSIASWRDVDAALSKTGARYSFQVAKVDNGRCDPVAGTNTGESLPLASIFKLYVLHALAGAVQHNTVSWDDLLTVTAKSKAVGSSGLELPVGARVSVRTAAEKMIATSDNMATDLLIERLGTRAIEEALASAGHHDPASMTPFPTMYELFSVGWGKPDLRDQWKHATQQVRAQILRQTNSTPYQPDPTRAHTPASNYGAEWYGSAEDICRVHAALRADAVGPASPVRQIMSAVPGIQLDRSVWPYIGAKAGGLPGDLTFSWYAVDKTGQPWVVSFQLNWPRDHGPTVTGWMLQVARQVFALIAPQ
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- González-Zamorano M et al. [2009]. Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
