Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in pantothenate biosynthesis [catalytic activity: ATP + (R)-pantoate + beta-alanine = AMP + pyrophosphate + (R)-pantothenate].
ProductPantoate--beta-alanine ligase PanC (pantothenate synthetase) (pantoate activating enzyme)
CommentsRv3602c, (MTCY07H7B.20), len: 309 aa. panC, pantoate--beta-alanine ligase, equivalent to O69524|PANC_MYCLE|ML0230|MLCB2548.01c pantoate--beta-alanine ligase from Mycobacterium leprae (313 aa), FASTA scores: opt: 1541, E(): 3.4e-84, (82.15% identity in 297 aa overlap). Also similar to others e.g. O67891|PANC_AQUAE|AQ_2132 from Aquifex aeolicus (282 aa) FASTA scores: opt: 774, E(): 8.6e-39, (46.9% identity in 273 aa overlap); Q9HV69|PANC_PSEAE|PA4730 from Pseudomonas aeruginosa (283 aa), FASTA scores: opt: 770, E(): 1.5e-38, (51.45% identity in 276 aa overlap); Q9A6C8|CC2166 from Caulobacter crescentus (285 aa), FASTA scores: opt: 744, E(): 5.2e-37, (47.75% identity in 268 aa overlap); P31663|PANC_ECOLI|B0133 from Escherichia coli strain K12 (283 aa), FASTA scores: opt: 695, E(): 4.1e-34, (46.1% identity in 271 aa overlap); etc. Belongs to the pantothenate synthetase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40442814045210-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3602c|panC
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN