Gene Rv3602c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in pantothenate biosynthesis [catalytic activity: ATP + (R)-pantoate + beta-alanine = AMP + pyrophosphate + (R)-pantothenate]. |
| Product | Pantoate--beta-alanine ligase PanC (pantothenate synthetase) (pantoate activating enzyme) |
| Comments | Rv3602c, (MTCY07H7B.20), len: 309 aa. panC, pantoate--beta-alanine ligase, equivalent to O69524|PANC_MYCLE|ML0230|MLCB2548.01c pantoate--beta-alanine ligase from Mycobacterium leprae (313 aa), FASTA scores: opt: 1541, E(): 3.4e-84, (82.15% identity in 297 aa overlap). Also similar to others e.g. O67891|PANC_AQUAE|AQ_2132 from Aquifex aeolicus (282 aa) FASTA scores: opt: 774, E(): 8.6e-39, (46.9% identity in 273 aa overlap); Q9HV69|PANC_PSEAE|PA4730 from Pseudomonas aeruginosa (283 aa), FASTA scores: opt: 770, E(): 1.5e-38, (51.45% identity in 276 aa overlap); Q9A6C8|CC2166 from Caulobacter crescentus (285 aa), FASTA scores: opt: 744, E(): 5.2e-37, (47.75% identity in 268 aa overlap); P31663|PANC_ECOLI|B0133 from Escherichia coli strain K12 (283 aa), FASTA scores: opt: 695, E(): 4.1e-34, (46.1% identity in 271 aa overlap); etc. Belongs to the pantothenate synthetase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4044281 | 4045210 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3602c|panC
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Wang S et al. [2003]. Crystal structures of a pantothenate synthetase from M. tuberculosis and its complexes with substrates and a reaction intermediate. Structure
- Wang S et al. [2006]. Crystal structure of the pantothenate synthetase from Mycobacterium tuberculosis, snapshots of the enzyme in action. Structure
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant