Gene Rv3607c (folX)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in folate biosynthesis. Catalyzes the conversion of 7,8-dihydroneopterin to 6- hydroxymethyl-7,8-dihydropterin [catalytic activity: 2-amino-4-hydroxy-6-(D-erythro-1,2,3-trihydroxypropyl)-7,8-dihydropteridine = 2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine + glycolaldehyde]. |
| Product | Probable dihydroneopterin aldolase FolB (DHNA) |
| Comments | Rv3607c, (MTCY07H7B.15), len: 133 aa. Probable folB, dihydroneopterin aldolase, equivalent to O69529|FOLB_MYCLE|ML0225|MLCB2548.06c probable dihydroneopterin aldolase from Mycobacterium leprae (132 aa), FASTA scores: opt: 673, E(): 5.1e-37, (74.8% identity in 131 aa overlap). Also similar to many e.g. Q9X8I0|FOLB_STRCO|SCE9.07 from Streptomyces coelicolor (119 aa), FASTA scores: opt: 334, E(): 4.5e-15, (46.15% identity in 117 aa overlap); P74342|FOLB_SYNY3|SLR1626 from Synechocystis sp. strain PCC 6803 (118 aa) FASTA scores: opt: 287, E(): 5e-12, (38.45% identity in 117 aa overlap); P28823|FOLB_BACSU|FOLA from Bacillus subtilis (120 aa), FASTA scores: opt: 283, E(): 9.2e-12, (39.0% identity in 118 aa overlap); etc. Belongs to the DHNA family. Note that previously known as folX. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4048744 | 4049145 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3607c|folB
MADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASRAAEIVAGPPRKLIETVGAEIADHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSRRGGRGWVVPAGGAV
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Goulding CW et al. [2005]. Regulation by oligomerization in a mycobacterial folate biosynthetic enzyme. Structure
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
