Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in folate biosynthesis. Catalyzes the conversion of 7,8-dihydroneopterin to 6- hydroxymethyl-7,8-dihydropterin [catalytic activity: 2-amino-4-hydroxy-6-(D-erythro-1,2,3-trihydroxypropyl)-7,8-dihydropteridine = 2-amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine + glycolaldehyde].
ProductProbable dihydroneopterin aldolase FolB (DHNA)
CommentsRv3607c, (MTCY07H7B.15), len: 133 aa. Probable folB, dihydroneopterin aldolase, equivalent to O69529|FOLB_MYCLE|ML0225|MLCB2548.06c probable dihydroneopterin aldolase from Mycobacterium leprae (132 aa), FASTA scores: opt: 673, E(): 5.1e-37, (74.8% identity in 131 aa overlap). Also similar to many e.g. Q9X8I0|FOLB_STRCO|SCE9.07 from Streptomyces coelicolor (119 aa), FASTA scores: opt: 334, E(): 4.5e-15, (46.15% identity in 117 aa overlap); P74342|FOLB_SYNY3|SLR1626 from Synechocystis sp. strain PCC 6803 (118 aa) FASTA scores: opt: 287, E(): 5e-12, (38.45% identity in 117 aa overlap); P28823|FOLB_BACSU|FOLA from Bacillus subtilis (120 aa), FASTA scores: opt: 283, E(): 9.2e-12, (39.0% identity in 118 aa overlap); etc. Belongs to the DHNA family. Note that previously known as folX.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomicsDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40487444049145-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3607c|folB
MADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASRAAEIVAGPPRKLIETVGAEIADHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSRRGGRGWVVPAGGAV