Gene Rv3613c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv3613c, (MTCY07H7B.09), len: 53 aa. Hypothetical unknown protein. |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h of starvation (see citation below). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4053881 | 4054042 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3613c|Rv3613c
MCTMPKLWRAFMAGRPLGSTFTPRQPTGAAPNHVRALDDSIDPSSAPAARAAL
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rickman L, Scott C, Hunt DM, Hutchinson T, Menendez MC, Whalan R, Hinds J, Colston MJ, Green J and Buxton RS [2005]. A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor. Transcriptome
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome