Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductESX-1 secretion-associated protein EspC
CommentsRv3615c, (MTCY07H7B.07), len: 103 aa. EspC, ESX-1 secretion-associated protein, equivalent to Q49723|ML0406|B1620_C2_214|MLCL383 hypothetical 11.1 KDA protein from Mycobacterium leprae (106 aa), FASTA scores: opt: 364, E(): 4.1e-18, (60.85% identity in 92 aa overlap). Also shows similarity to P96212|Rv3865|MTCY01A6.03 hypothetical 10.6 KDA protein from Mycobacterium tuberculosis (103 aa), FASTA scores: opt: 198, E(): 6.8e-07, (36.25% identity in 102 aa overlap). Has been shown to interact with itself, by yeast two-hybrid analysis (See MacGurn et al., 2005).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by microarray analysis: transcription up-regulated at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see Fisher et al., 2002), and possibly down-regulated by hrcA|Rv2374c (see Stewart et al., 2002). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis (Erdman) Rv3615c transposon mutant had decreased expression of Rv3615c and Rv3614c and exhibited a secretion defect; mutant failed to grow in bone marrow-derived macrophages (See MacGurn et al., 2005). EspD|Rv3614c stabilizes EspA|Rv3616c and EspC|Rv3615c (See Chen et al., 2012).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40548124055123-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3615c|espC
MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT
      
Bibliography