Gene Rv3622c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein PE32 |
| Comments | Rv3622c, (MTCY15C10.30), len: 99 aa. PE32, Member of the Mycobacterium tuberculosis PE family (see Brennan and Delogu, 2002), but no glycine rich C-terminus present. Similar to others e.g. O53938|Rv1788|MTV049.10 (99 aa), FASTA scores: opt: 376, E(): 7.1e-17, (65.6% identity in 96 aa overlap). |
| Functional category | Pe/ppe |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4061899 | 4062198 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3622c|PE32
MSIMHAEPEMLAATAGELQSINAVARAGNAAVAGPTTGVVPAAADLVSLLTASQFAAHAQLYQAISAEAMAVQEQLATTLGISAGSYAATEAANAATIA
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
