Gene Rv3624c (hprT)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in purine salvage [catalytic activity: imp + pyrophosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate (guanine can replace hypoxanthine to produce GMP)]. |
| Product | Hypoxanthine-guanine phosphoribosyltransferase Hpt (HGPRT) (HGPRTase) (hypoxanthine phosphoribosyltransferase) (imp pyrophosphorylase) (imp diphosphorylase) (transphosphoribosyltransferase) (guanine phosphoribosyltransferase) |
| Comments | Rv3624c, (MTCY15C10.28), len: 216 aa. Hpt (alternate gene name: hprT), hypoxanthine-guanine phosphoribosyltransferase (but seems to have a 35 aa extension at N-terminus), equivalent to other mycobacterial hypoxanthine-guanine phosphoribosyltransferases e.g. P96794 from Mycobacterium avium (203 aa), FASTA scores: opt: 1136, E(): 1.2e-65, (88.5% identity in 200 aa overlap); and O69537|HPT|ML0214 from Mycobacterium leprae (213 aa), FASTA scores: opt: 1115, E(): 2.8e-64, (81.6% identity in 212 aa overlap). Also similar to others e.g. Q9X8I5|SCE9.12c from Streptomyces coelicolor (187 aa), FASTA scores: opt: 724, E(): 2.4e-39, (60.55% identity in 180 aa overlap); P37472|HPRT_BACSU|HPT from Bacillus subtilis (180 aa) FASTA scores: opt: 574, E(): 9.1e-30, (48.6% identity in 181 aa overlap); etc. Equivalent to AAK48087 from Mycobacterium tuberculosis strain CDC1551 (202 aa) but longer 14 aa. Contains PS00103 Purine/pyrimidine phosphoribosyltransferases signature. Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4063254 | 4063904 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3624c|hpt
LTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
Bibliography
- Biazus G et al. [2009]. Hypoxanthine-guanine phosphoribosyltransferase from Mycobacterium tuberculosis H37Rv: cloning, expression, and biochemical characterization. Function Product
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
