Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in galactofuranosyl biosynthesis: converts UDO-GlcP to UDP-GalP [catalytic activity: UDP-glucopyranose = UDP-galactopyranose].
ProductUDP-glucose 4-epimerase GalE1 (galactowaldenase) (UDP-galactose 4-epimerase) (uridine diphosphate galactose 4-epimerase) (uridine diphospho-galactose 4-epimerase)
CommentsRv3634c, (MTCY15C10.18), len: 314 aa. GalE1, UDP-glucose 4-epimerase (see citations below), equivalent to O69544|ML0204|RMLB2|MLCB2548.27c putative sugar dehydratase (putative sugar-nucleotide dehydratase) from Mycobacterium leprae (319 aa), FASTA scores: opt: 1798, E(): 8.2e-100, (86.4% identity in 309 aa overlap). Also similar to other UDP-glucose 4-epimerases e.g. Q9WYX9|TM0509 from Thermotoga maritima (309 aa) FASTA scores: opt: 877, E(): 4.8e-45, (45.8% identity in 308 aa overlap); Q57664|GALE_METJA|MJ0211 from Methanococcus jannaschii (305 aa), FASTA scores: opt: 792, E(): 5.4e-40, (42.05% identity in 309 aa overlap); Q9K6S7|BH3649 from Bacillus halodurans (311 aa), FASTA scores: opt: 723, E(): 7e-36, (40.5% identity in 316 aa overlap); Q9HSV1|GALE2|VNG0063G from Halobacterium sp. strain NRC-1 (328 aa), FASTA scores: opt: 597, E(): 2.3e-28, (36.35% identity in 322 aa overlap); etc. Contains short-chain alcohol dehydrogenase family signature (PS00061) but this maynot be significant. Belongs to the sugar epimerase family. Note that previously known as rmlB2, a dTDP-glucose 4,6-dehydratase (see Ma et al., 2001).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics at the Statens Serum Institute (Denmark) (see Rosenkrands et al., 2000). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 4h of starvation (see Betts et al., 2002).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40726674073611-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3634c|galE1
VRALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNLEHLADNSAHVFVEADIVTADLHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGVRKIVHTSSGGSIYGTPPEYPTPETAPTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHIAPANVYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRVSADVGGGLRFNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDLKRSCLDIGLAERVLGWRPQIELADGVRRTVEYFRHKHTD
      
Bibliography