Gene Rv3637
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly required for the transposition of an insertion element. |
| Product | Possible transposase |
| Comments | Rv3637, (MTCY15C10.15c), len: 166 aa. Possible transposase. C-terminal end highly similar to Q9RLQ9|ISTA putative transposase a (fragment) from Mycobacterium bovis (102 aa), FASTA scores: opt: 397, E(): 1.4e-19, (58.8% identity in 102 aa overlap). Weakly similar to others e.g. Q9KJ02 putative transposase (fragment) from Polyangium cellulosum (329 aa), FASTA scores: opt: 191, E(): 1.6e-05, (32.1% identity in 134 aa overlap); Q9LCU2|ISTA cointegrase from Pseudomonas aeruginosa (382 aa) FASTA scores: opt: 144, E(): 0.024, (26.8% identity in 123 aa overlap); P15025|ISTA_PSEAE transposase for insertion sequence element IS21 from Pseudomonas aeruginosa (390 aa), FASTA scores: opt: 144, E(): 0.025, (26.85% identity in 123 aa overlap); etc. Also highly similar to C-terminal end of P96288|Rv2943|MTCY24G1.06c hypothetical 45.8 KDA protein from Mycobacterium tuberculosis (413 aa) FASTA scores: opt: 722, E(): 1.5e-40, (63.7% identity in 168 aa overlap). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4076484 | 4076984 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3637|Rv3637
LPGRVFASPADFNTQLQAWLVRANHRQHRVLGCRPADRIEADTAAMLTLPPVGPSIGWRTSTRLPRDHYVRLDGNDYSVHPVAIGRRIEITADLSRVRVWCGGTLVADHDRIWAKHQTISDPEHVVAAKLLRRKRFDIVGPPHHVEVEQRLLTTYDTVLGLDGPVA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
