Gene Mb3661
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible transposase |
| Comments | Mb3661, -, len: 166 aa. Equivalent to Rv3637, len: 166 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 166 aa overlap). Possible transposase. C-terminal end highly similar to Q9RLQ9|ISTA PUTATIVE TRANSPOSASE A (FRAGMENT) from Mycobacterium bovis (102 aa), FASTA scores: opt: 397, E(): 1.4e-19, (58.8% identity in 102 aa overlap). Weakly similar to others e.g. Q9KJ02 PUTATIVE TRANSPOSASE (FRAGMENT) from Polyangium cellulosum (329 aa), FASTA scores: opt: 191, E(): 1.6e-05, (32.1% identity in 134 aa overlap); Q9LCU2|ISTA COINTEGRASE from Pseudomonas aeruginosa (382 aa) FASTA scores: opt: 144,E(): 0.024, (26.8% identity in 123 aa overlap); P15025|ISTA_PSEAE TRANSPOSASE FOR INSERTION SEQUENCE ELEMENT IS21 from Pseudomonas aeruginosa (390 aa), FASTA scores: opt: 144, E(): 0.025, (26.85% identity in 123 aa overlap); etc. Also highly similar to C-terminal end of P96288|Rv2943|MTCY24G1.06c HYPOTHETICAL 45.8 KDA PROTEIN from Mycobacterium tuberculosis (413 aa) FASTA scores: opt: 722, E(): 1.5e-40, (63.7% identity in 168 aa overlap). |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4013721 | 4014221 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3661|Mb3661
MPGRVFASPADFNTQLQAWLVRANHRQHRVLGCRPADRIEADTAAMLTLPPVGPSIGWRTSTRLPRDHYVRLDGNDYSVHPVAIGRRIEITADLSRVRVWCGGTLVADHDRIWAKHQTISDPEHVVAAKLLRRKRFDIVGPPHHVEVEQRLLTTYDTVLGLDGPVA
Bibliography
No article yet recorded
