Gene Rv3657c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved alanine rich membrane protein |
| Comments | Rv3657c, (MTV025.005c), len: 191 aa. Possible conserved membrane protein, rich in ala residues, similar to Q9X919|SCH5.17c putative integral membrane protein from Streptomyces coelicolor (267 aa), FASTA scores: opt: 324, E(): 4.7e-12, (40.9% identity in 154 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4095540 | 4096115 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3657c|Rv3657c
MALWLGAGPSVVRARAGRPPRAHRPHQGLLLGRTDVADPLAVAASLDVLAVCLAAGMAVSTAAAATAAVAPPRLARVLRRAADLLALGADPNIAWSRPPDLPPGTHDAQTDAVLRLARRSAASGAALADGIVELAVQVRHDAAQAAAAAAERAGVLIAGPLGLCFLPAFLCVGIVPLVVGLAGDVLQFGLV
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant