Gene Rv3658c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | Rv3658c, (MTV025.006c), len: 266 aa. Probable conserved transmembrane protein, similar to Q9X920|SCH5.18c putative integral membrane protein from Streptomyces coelicolor (321 aa), FASTA scores: opt: 335, E(): 4.1e-13, (38.05% identity in 247 aa overlap). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4096139 | 4096939 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3658c|Rv3658c
MSGIASAALILSLALVVLPGSPRCRLTPDDTGRRVLLVGARRVAWGVGCVAVGVAALLPLPTVVAVAVLGATLGLRYRRRRRYLRRSREGQALEAALELVVGELRAGAHPVRAFSIAADETGGPVAVALRAVAARARLGADVTAGLLAAARSSALPAYWERLAVCWQLGSDHGLAIASLMRAAQRDVAERQRFSARVSAGMAGARASAAILAILPLLGVLLGQLIGARPLSFLLTGRVGGWLLVVGLTLACAGLLWSDRITDRPVL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant