Gene Rv3659c (trbB)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3659c, (MTV025.007c), len: 352 aa. Conserved hypothetical protein, highly similar, but always shorter (various lengths) at N-terminus, to Q9X921|SCH5.19c putative secretory protein from Streptomyces coelicolor (523 aa), FASTA scores: opt: 1287, E(): 5.3e-66, (59.85% identity in 351 aa overlap); Q9HW98|PA4302 probable type II secretion system protein from Pseudomonas aeruginosa (421 aa), FASTA scores: opt: 776, E(): 5.4e-37, (42.8% identity in 320 aa overlap); AAK65510|CPAF2 probable CPAF2 PILUS assembly protein from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymA (497 aa) FASTA scores: opt: 769, E(): 1.5e-36, (40.45% identity in 309 aa overlap); Q9KY93|SCK15.11 putative secretory protein from Streptomyces coelicolor (445 aa), FASTA scores: opt: 751, E(): 1.5e-35, (38.15% identity in 333 aa overlap); etc. Contains PS00017 ATP/GTP binding site motif A (P-loop). Note that previously known as trbB. |
| Functional category | Conserved hypotheticals |
| Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4096936 | 4097994 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3659c|Rv3659c
MLGDTEVLANLRVLQTELTGAGILEPLLSADGTTDVLVTAPDSVWVDDGNGLRRSQIRFADESAVRRLAQRLALAAGRRLDDAQPWVDGQLTGIGVGGFAVRLHAVLPPVATQGTCLSLRVLRPATQDLAALAAAGAIDPAAAALVADIVTARLAFLVCGGTGAGKTTLLAAMLGAVSPDERIVCVEDAAELAPRHPHLVKLVARRANVEGIGEVTVRQLVRQALRMRPDRIVVGEVRGAEVVDLLAALNTGHEGGAGTVHANNPGEVPARMEALGALGGLDRAALHSQLAAAVQVLLHVARDRAGRRRLAEIAVLRQAEGRVQAVTVWHADRGMSDDAAALHDLLRSRASA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
