Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly plays a regulatory role in celular differentiation.
ProductConserved hypothetical protein
CommentsRv3660c, (MTV025.008c), len: 350 aa. Conserved hypothetical protein, similar to O33612 protein concerned in inhibition of morphological differentiation in Streptomyces azureus from Streptomyces cyaneus (Streptomyces curacoi) (370 aa), FASTA scores: opt: 655, E(): 5.9e-31, (42.2% identity in 315 aa overlap); Q9X922|SCH5.20c putative septum site determining protein from Streptomyces coelicolor (396 aa), FASTA scores: opt: 592, E(): 2.9e-27, (43.25% identity in 275 aa overlap). And shows some similarity to AAK65513|CPAE2 probable CPAE2 PILUS assembly protein from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymA (586 aa) FASTA scores: opt: 212, E(): 5.1e-05, (25.75% identity in 295 aa overlap); and several cell division inhibitors or septum site-determining proteins. Equivalent to AAK48124 from Mycobacterium tuberculosis strain CDC1551 (261 aa) but longer 89 aa.
Functional category-
ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
OperonB11 and Rv3660c are not co-transcribed, by RT-PCR (See Arnvig and Young, 2009).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40980964099148-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3660c|Rv3660c
MLTDPGLRDELDRVAAAVGVRVVHLGGRHPVSRKTWSAAAAVVLDHAAADRCGRLALPRRTHVSVLTGTEAATATWAAAITVGAQHVLRMPEQEGELVRELAEAAESARDDGICGAVVAVIGGRGGAGASLFAVALAQAAADALLVDLDPWAGGIDLLVGGETAPGLRWPDLALQGGRLNWSAVRAALPRPRGISVLSGTRRGYELDAGPVDAVIDAGRRGGVTVVCDLPRRLTDATQAALDAADLVVLVSPCDVRACAAAATMAPVLTAINPNLGLVVRGPSPGGLRAAEVADVAGVPLLASMRAQPRLAEQLEHGGLRLRRRSVLASAARRVLGVLPRAGSGRHGRAA