Gene Rv3660c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly plays a regulatory role in celular differentiation. |
| Product | Conserved hypothetical protein |
| Comments | Rv3660c, (MTV025.008c), len: 350 aa. Conserved hypothetical protein, similar to O33612 protein concerned in inhibition of morphological differentiation in Streptomyces azureus from Streptomyces cyaneus (Streptomyces curacoi) (370 aa), FASTA scores: opt: 655, E(): 5.9e-31, (42.2% identity in 315 aa overlap); Q9X922|SCH5.20c putative septum site determining protein from Streptomyces coelicolor (396 aa), FASTA scores: opt: 592, E(): 2.9e-27, (43.25% identity in 275 aa overlap). And shows some similarity to AAK65513|CPAE2 probable CPAE2 PILUS assembly protein from Rhizobium meliloti (Sinorhizobium meliloti) plasmid pSymA (586 aa) FASTA scores: opt: 212, E(): 5.1e-05, (25.75% identity in 295 aa overlap); and several cell division inhibitors or septum site-determining proteins. Equivalent to AAK48124 from Mycobacterium tuberculosis strain CDC1551 (261 aa) but longer 89 aa. |
| Functional category | - |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Operon | B11 and Rv3660c are not co-transcribed, by RT-PCR (See Arnvig and Young, 2009). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al.,2003). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4098096 | 4099148 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3660c|Rv3660c
MLTDPGLRDELDRVAAAVGVRVVHLGGRHPVSRKTWSAAAAVVLDHAAADRCGRLALPRRTHVSVLTGTEAATATWAAAITVGAQHVLRMPEQEGELVRELAEAAESARDDGICGAVVAVIGGRGGAGASLFAVALAQAAADALLVDLDPWAGGIDLLVGGETAPGLRWPDLALQGGRLNWSAVRAALPRPRGISVLSGTRRGYELDAGPVDAVIDAGRRGGVTVVCDLPRRLTDATQAALDAADLVVLVSPCDVRACAAAATMAPVLTAINPNLGLVVRGPSPGGLRAAEVADVAGVPLLASMRAQPRLAEQLEHGGLRLRRRSVLASAARRVLGVLPRAGSGRHGRAA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant