Gene Rv3665c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Involved in active transport of dipeptide across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
Product | Probable dipeptide-transport integral membrane protein ABC transporter DppB |
Comments | Rv3665c, (MTV025.013c), len: 308 aa. Probable dppB, dipeptide-transport integral membrane protein ABC-transporter (see citation below), similar to many peptide permeases e.g. Q9F352|SC9E12.03 putative peptide transport system integral membrane protein from Streptomyces coelicolor (307 aa), FASTA scores: opt: 1145, E(): 1.8e-61, (57.65% identity in 307 aa overlap); Q53191|Y4TP_RHISN probable peptide ABC transporter permease protein Rhizobium sp. strain NGR234 (313 aa), FASTA scores: opt: 653, E(): 5.2e-32, (31.2% identity in 314 aa overlap); P24138|OPPB_BACSU oligopeptide transport system permease from Bacillus subtilis (311 aa), FASTA scores: opt: 643, E(): 2.1e-31, (33.45% identity in 305 aa overlap); etc. Belongs to the OPPBC subfamily. |
Functional category | Cell wall and cell processes |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4104531 | 4105457 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3665c|dppB MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDDPFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIAGLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGIVLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAALDPRIRYG
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant