Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in active transport of dipeptide across the membrane (import). Responsible for the translocation of the substrate across the membrane.
ProductProbable dipeptide-transport integral membrane protein ABC transporter DppB
CommentsRv3665c, (MTV025.013c), len: 308 aa. Probable dppB, dipeptide-transport integral membrane protein ABC-transporter (see citation below), similar to many peptide permeases e.g. Q9F352|SC9E12.03 putative peptide transport system integral membrane protein from Streptomyces coelicolor (307 aa), FASTA scores: opt: 1145, E(): 1.8e-61, (57.65% identity in 307 aa overlap); Q53191|Y4TP_RHISN probable peptide ABC transporter permease protein Rhizobium sp. strain NGR234 (313 aa), FASTA scores: opt: 653, E(): 5.2e-32, (31.2% identity in 314 aa overlap); P24138|OPPB_BACSU oligopeptide transport system permease from Bacillus subtilis (311 aa), FASTA scores: opt: 643, E(): 2.1e-31, (33.45% identity in 305 aa overlap); etc. Belongs to the OPPBC subfamily.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41045314105457-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3665c|dppB
MGWYVARRVAVMVPVFLGATLLIYGMVFLLPGDPVAALAGDRPLTPAVAAQLRSHYHLDDPFLVQYLRYLGGILHGDLGRAYSGLPVSAVLAHAFPVTIRLALIALAVEAVLGIGFGVIAGLRQGGIFDSAVLVTGLVIIAIPIFVLGFLAQFLFGVQLEIAPVTVGERASVGRLLLPGIVLGAMSFAYVVRLTRSAVAANAHADYVRTATAKGLSRPRVVTVHILRNSLIPVVTFLGADLGALMGGAIVTEGIFNIHGVGGVLYQAVTRQETPTVVSIVTVLVLIYLITNLLVDLLYAALDPRIRYG