Gene Rv3677c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible hydrolase |
| Comments | Rv3677c, (MTV025.025c), len: 264 aa. Possible hydrolase, equivalent to Q9CB90|ML2303 putative hydrolase from Mycobacterium leprae (262 aa) FASTA scores: opt: 1400, E(): 8.5e-81, (82.05% identity in 262 aa overlap). Also similar to other hydrolases and hypothetical proteins e.g. Q9XA41|SCH17.06c putative hydrolase from Streptomyces coelicolor (256 aa) FASTA scores: opt: 609, E(): 3.9e-31, (54.65% identity in 247 aa overlap); Q9A9Q1|CC0923 metallo-beta-lactamase family protein from Caulobacter crescentus (297 aa), FASTA scores: opt: 306, E(): 4.7e-12, (35.45% identity in 268 aa overlap); Q9Y392 CGI-83 protein from Homo sapiens (Human) (288 aa), FASTA scores: opt: 281, E(): 1.7e-10, (33.2% identity in 259 aa overlap); Q9F7R6 predicted metallobeta lactamase fold protein from uncultured proteobacterium EBAC31A08 (265 aa), FASTA scores: opt: 257, E(): 5.1e-09, (32.55% identity in 252 aa overlap); Q9PBI4|XF2160 hydroxyacylglutathione hydrolase from Xylella fastidiosa (258 aa), FASTA scores: opt: 232, E(): 1.9e-07, (30.3% identity in 165 aa overlap); etc. Recombinant protein has beta lactamase activity (See Nampoothiri et al., 2008). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4117258 | 4118052 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3677c|Rv3677c
MSKTAESLTHPAYGQLRAVTDTASVLLADNPGLLTLDGTNTWVLRGPLSDELVVVDPGPDDDEHLARVAALGRIALVLISHRHGDHTSGIDKLVALTGAPVRAADPQFLRRDGETLTDGEVIDVAGLTITVLATPGHTADSLSFVLDDAVLTADTVLGCGTTVIDKEDGSLADYLESLHRLRGLGRRTVLPGHGPDLLDLEAIASGYLLHRHERLEQIRAALRDLGDDATVREVVEHVYLDVDEKLWNAAEWSVQAQLDYLRTR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Nampoothiri KM et al. [2008]. Molecular cloning, overexpression and biochemical characterization of hypothetical beta-lactamases of Mycobacterium tuberculosis H37Rv. Biochemistry
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
