Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible hydrolase
CommentsRv3677c, (MTV025.025c), len: 264 aa. Possible hydrolase, equivalent to Q9CB90|ML2303 putative hydrolase from Mycobacterium leprae (262 aa) FASTA scores: opt: 1400, E(): 8.5e-81, (82.05% identity in 262 aa overlap). Also similar to other hydrolases and hypothetical proteins e.g. Q9XA41|SCH17.06c putative hydrolase from Streptomyces coelicolor (256 aa) FASTA scores: opt: 609, E(): 3.9e-31, (54.65% identity in 247 aa overlap); Q9A9Q1|CC0923 metallo-beta-lactamase family protein from Caulobacter crescentus (297 aa), FASTA scores: opt: 306, E(): 4.7e-12, (35.45% identity in 268 aa overlap); Q9Y392 CGI-83 protein from Homo sapiens (Human) (288 aa), FASTA scores: opt: 281, E(): 1.7e-10, (33.2% identity in 259 aa overlap); Q9F7R6 predicted metallobeta lactamase fold protein from uncultured proteobacterium EBAC31A08 (265 aa), FASTA scores: opt: 257, E(): 5.1e-09, (32.55% identity in 252 aa overlap); Q9PBI4|XF2160 hydroxyacylglutathione hydrolase from Xylella fastidiosa (258 aa), FASTA scores: opt: 232, E(): 1.9e-07, (30.3% identity in 165 aa overlap); etc. Recombinant protein has beta lactamase activity (See Nampoothiri et al., 2008).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41172584118052-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3677c|Rv3677c
MSKTAESLTHPAYGQLRAVTDTASVLLADNPGLLTLDGTNTWVLRGPLSDELVVVDPGPDDDEHLARVAALGRIALVLISHRHGDHTSGIDKLVALTGAPVRAADPQFLRRDGETLTDGEVIDVAGLTITVLATPGHTADSLSFVLDDAVLTADTVLGCGTTVIDKEDGSLADYLESLHRLRGLGRRTVLPGHGPDLLDLEAIASGYLLHRHERLEQIRAALRDLGDDATVREVVEHVYLDVDEKLWNAAEWSVQAQLDYLRTR