Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3686c, (MTV025.034c), len: 110 aa. Hypothetical protein, similar to P96893|Rv3288c|MTCY71.28c hypothetical 15.2 KDA protein from Mycobacterium tuberculosis (and Mycobacterium bovis) (137 aa) FASTA scores: opt: 106, E(): 5.6, (29.1% identity in 79 aa overlap); and a few hypothetical proteins e.g. Q9GUV6|L2259.2 from Leishmania major (360 aa) FASTA scores: opt: 118, E(): 2.1, (28.7% identity in 101 aa overlap). Equivalent to AAK48155 from Mycobacterium tuberculosis strain CDC1551 (166 aa) but shorter 56 aa.
Functional categoryConserved hypotheticals
TranscriptomicsDNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41287514129083-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3686c|Rv3686c
MVYTGSDAGDHASAPQPSGSGSVPASVNVPGLVVAAVWAVGLVAGLVALTIGHLAVAAAALVVAVMAPWCRVAYIAHGQHRVCGETLRGTPAGETASFPTGWRGLRFSTR