Gene Rv3686c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3686c, (MTV025.034c), len: 110 aa. Hypothetical protein, similar to P96893|Rv3288c|MTCY71.28c hypothetical 15.2 KDA protein from Mycobacterium tuberculosis (and Mycobacterium bovis) (137 aa) FASTA scores: opt: 106, E(): 5.6, (29.1% identity in 79 aa overlap); and a few hypothetical proteins e.g. Q9GUV6|L2259.2 from Leishmania major (360 aa) FASTA scores: opt: 118, E(): 2.1, (28.7% identity in 101 aa overlap). Equivalent to AAK48155 from Mycobacterium tuberculosis strain CDC1551 (166 aa) but shorter 56 aa. |
| Functional category | Conserved hypotheticals |
| Transcriptomics | DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4128751 | 4129083 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3686c|Rv3686c
MVYTGSDAGDHASAPQPSGSGSVPASVNVPGLVVAAVWAVGLVAGLVALTIGHLAVAAAALVVAVMAPWCRVAYIAHGQHRVCGETLRGTPAGETASFPTGWRGLRFSTR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
