Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved transmembrane protein
CommentsRv3694c, (MTV025.042c), len: 330 aa. Possible conserved transmembrane protein, highly similar to Q9KZM4|SCE34.01c putative integral membrane protein from Streptomyces coelicolor (335 aa), FASTA scores: opt: 1113, E(): 2.5e-60, (51.5% identity in 334 aa overlap); and similar to Q9KEW6|BH0733 hypothetical protein from Bacillus halodurans (355 aa), FASTA scores: opt: 381, E(): 6.1e-16, (24.15% identity in 331 aa overlap); Q9AAM9|CC0568 hypothetical protein from Caulobacter crescentus (332 aa), FASTA scores: opt: 352, E(): 3.3e-14, (30.3% identity in 310 aa overlap); P74166|SLR1478 hypothetical 35.4 KDA protein from Synechocystis sp. strain PCC 6803 (317 aa), FASTA scores: opt: 330, E(): 6.8e-13, (25.65% identity in 308 aa overlap); etc. C-terminal end shows similarity to O29631|AF0624|AE001061_10 conserved hypothetical protein (putative nifU protein) from Archaeoglobus fulgidus (185 aa), FASTA scores: opt: 154, E(): 0.021, (29.0% identity in 131 aa overlap). Equivalent to AAK48163 from Mycobacterium tuberculosis strain CDC1551 (395 aa) but shorter 65 aa. Also some similarity to MTCY428_20 hypothetical 43.7 KDA protein from Mycobacterium tuberculosis.
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41361224137114-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3694c|Rv3694c
VDVDAFLLTNRGTWDRLDHLIKKRHSLSGAEIDELVELYQRVSTHLSMLRSASSDQLMTGRLSSLVARARSAVTGAHAPLTRTFIRFWTVSFPVVAYRTWRWWLATAVAFFAVVVLIGFWVAGSHEVQSAIGTPTEIDELVSHDVQSYYSEHPAASFALQVWVNNSWVATTCIAMSVVLGLPIPLVLFDNAANVGLIAGLMFQAGKGDFLLGLLLPHGLLELTAVFLAAAIGMRLGWSVISAGNRPRGQVLAEQGRGVVSVAVGLVGVFLVAGLIEAVVTPSPLPTFVRIAVGIIAEAVFLSYIGYFGRRAAQAGETGDMEDAPDVVPTG