Gene Rv3694c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane protein |
| Comments | Rv3694c, (MTV025.042c), len: 330 aa. Possible conserved transmembrane protein, highly similar to Q9KZM4|SCE34.01c putative integral membrane protein from Streptomyces coelicolor (335 aa), FASTA scores: opt: 1113, E(): 2.5e-60, (51.5% identity in 334 aa overlap); and similar to Q9KEW6|BH0733 hypothetical protein from Bacillus halodurans (355 aa), FASTA scores: opt: 381, E(): 6.1e-16, (24.15% identity in 331 aa overlap); Q9AAM9|CC0568 hypothetical protein from Caulobacter crescentus (332 aa), FASTA scores: opt: 352, E(): 3.3e-14, (30.3% identity in 310 aa overlap); P74166|SLR1478 hypothetical 35.4 KDA protein from Synechocystis sp. strain PCC 6803 (317 aa), FASTA scores: opt: 330, E(): 6.8e-13, (25.65% identity in 308 aa overlap); etc. C-terminal end shows similarity to O29631|AF0624|AE001061_10 conserved hypothetical protein (putative nifU protein) from Archaeoglobus fulgidus (185 aa), FASTA scores: opt: 154, E(): 0.021, (29.0% identity in 131 aa overlap). Equivalent to AAK48163 from Mycobacterium tuberculosis strain CDC1551 (395 aa) but shorter 65 aa. Also some similarity to MTCY428_20 hypothetical 43.7 KDA protein from Mycobacterium tuberculosis. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4136122 | 4137114 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3694c|Rv3694c
VDVDAFLLTNRGTWDRLDHLIKKRHSLSGAEIDELVELYQRVSTHLSMLRSASSDQLMTGRLSSLVARARSAVTGAHAPLTRTFIRFWTVSFPVVAYRTWRWWLATAVAFFAVVVLIGFWVAGSHEVQSAIGTPTEIDELVSHDVQSYYSEHPAASFALQVWVNNSWVATTCIAMSVVLGLPIPLVLFDNAANVGLIAGLMFQAGKGDFLLGLLLPHGLLELTAVFLAAAIGMRLGWSVISAGNRPRGQVLAEQGRGVVSVAVGLVGVFLVAGLIEAVVTPSPLPTFVRIAVGIIAEAVFLSYIGYFGRRAAQAGETGDMEDAPDVVPTG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant