Gene Rv3705A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical proline rich protein |
| Comments | Rv3705A, len: 129 aa. Conserved hypothetical protein, similar to downstream ORF O69674|Rv3706c|MTV025.054c conserved hypothetical proline rich protein from Mycobacterium tuberculosis (106 aa), FASTA scores: opt: 245, E(): 0.00013, (40.7% identity in 113 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4149091 | 4149480 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3705A|Rv3705A
MTETPQPAAPPPSAATTSPPPSPQQEKPPRLYRAAAWVVIVAGIVFTVAVIFFSGALVLGQGKCPYHRYYHHGMFRPVGPVAPGPGMGWVFGFPGGPPPPGMGPGFPGGPGGPAVGPTGPGPTTAPARP
Bibliography
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant