Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical proline rich protein
CommentsRv3705A, len: 129 aa. Conserved hypothetical protein, similar to downstream ORF O69674|Rv3706c|MTV025.054c conserved hypothetical proline rich protein from Mycobacterium tuberculosis (106 aa), FASTA scores: opt: 245, E(): 0.00013, (40.7% identity in 113 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41490914149480-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3705A|Rv3705A
MTETPQPAAPPPSAATTSPPPSPQQEKPPRLYRAAAWVVIVAGIVFTVAVIFFSGALVLGQGKCPYHRYYHHGMFRPVGPVAPGPGMGWVFGFPGGPPPPGMGPGFPGGPGGPAVGPTGPGPTTAPARP