Gene Rv3706c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical proline rich protein |
| Comments | Rv3706c, (MTV025.054c), len: 106 aa. Conserved ypothetical pro-rich protein, similar to upstream ORF Rv3705A (129 aa), and AAK48176|MT3808.1 hypothetical 13.0 KDA protein from Mycobacterium tuberculosis strain CDC1551 (129 aa), FASTA scores: opt: 245, E(): 4.4e-06, (40.7% identity in 113 aa overlap). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4149591 | 4149911 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3706c|Rv3706c
MRHMSETSETPTPPPHQTPKVFKAAAWVAIAAGTVFIVAVIFFTGYILGKHAGHGGFHHRQHHQHPAMMLRPGSPHGGPAAVRPGPGPGGPGQVPSSVSPPATPAP
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
