Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionMay play a role in DNA repair. It seems to be involved in an RECBC-independent recombinational process of DNA repair. It may act with RECF|Rv0003 (and RECO|Rv2362c ?) for modulating assembly of disassembly of RECA filaments.
ProductProbable recombination protein RecR
CommentsRv3715c, (MTV025.063c), len: 203 aa. Probable recR, recombination protein (see citation below), equivalent to O69520|RECR_MYCLE|ML2329|MLCB2407.21 recombination protein from Mycobacterium leprae (203 aa), FASTA scores: opt: 1246, E(): 9.2e-71, (91.6% identity in 202 aa overlap). Also highly similar to many e.g. Q9XAI4|RECR_STRCO|SC66T3.29c from Streptomyces coelicolor (199 aa), FASTA scores: opt: 952, E(): 1.9e-52, (68.3% identity in 202 aa overlap); P24277|RECR_BACSU|RECM|recd from Bacillus subtilis (198 aa), FASTA scores: opt: 696, E(): 1.8e-36, (50.5% identity in 198 aa overlap); Q9ZNA2|RECR_DEIRA|DR0198 from Deinococcus radiodurans (220 aa), FASTA scores: opt: 673, E(): 5.2e-35, (49.75% identity in 195 aa overlap); etc. Belongs to the RECR family.
Functional categoryInformation pathways
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41598894160500-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3715c|recR
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA