Gene Rv3724A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolysis of cutin (a polyester that forms the structure of plant cuticle). |
| Product | Probable cutinase precursor [first part] Cut5a |
| Comments | Rv3724A, (MTV025.072), len: 80 aa. Probable cut5a, truncated cutinase precursor, similar to N-terminal end of others e.g. Q9KK87 serine esterase cutinase from Mycobacterium avium (220 aa), FASTA scores: opt: 202, E(): 1.5e-06, (56.45% identity in 62 aa overlap); Q9XB09|RVD2-RV1758 protein (fragment) from Mycobacterium bovis BCG (143 aa), FASTA scores: opt: 200, E(): 1.5e-06, (61.4% identity in 57 aa overlap); and Q00298|CUTI_BOTCI|CUTA cutinase precursor from Botrytis cinerea (Botryotinia fuckeliana) (202 aa), FASTA scores: opt: 108, E(): 2.2, (40.4% identity in 52 aa overlap). Also highly similar to others from Mycobacterium tuberculosis e.g. O06318|CUT3_MYCTU|Rv3451|MT3557|MTCY13E12.04 probable cutinase precursor (247 aa), FASTA scores: opt: 189, E(): 1.2e-05, (58.0% identity in 50 aa overlap); Q50664|CUT2_MYCTU|Rv2301|MT2358|MTCY339.08c probable cutinase precursor (219 aa), FASTA scores: opt: 172, E(): 0.00015, (59.2% identity in 49 aa overlap); O06793|Rv1758|MTCY28.24|Z95890 hypothetical 17.9 KDA protein (174 aa), FASTA scores: opt: 641, E(): 2.7e-29, (57.2% identity in 166 aa overlap); O06319|Rv3452|MTY13E12.05; and U00015_11 from Mycobacterium leprae. Belongs to the cutinase family. Rest of cutinase ORF continues as Rv3724B|CUT5B, frameshifting could occur near position 4169668. Sequence has been checked but no errors found. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4169467 | 4169709 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3724A|cut5a
MDVIRWARRLAVVAGTAAAVTTPGLLSAHVPMVSAEPCPDVEVVFARGTGEPPGIGSVGGLFVDALRFPGWRQVTRGLRR
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
