Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
Productprobable cutinase [second part] cut5b
CommentsMb3751, cut5, len: 233 aa. Equivalent to Rv3724A (cut5a) and Rv3724B (cut5b), len: 80 aa and 187 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 67 aa overlap and 100.0% identity in 166 aa overlap). Probable cut5a, truncated cutinase precursor (EC 3.1.1.-),similar to N-terminal end of others e.g. Q9KK87 SERINE ESTERASE CUTINASE from Mycobacterium avium (220 aa), FASTA scores: opt: 202, E(): 1.5e-06, (56.45% identity in 62 aa overlap); Q9XB09|RVD2-RV1758 PROTEIN (FRAGMENT) from Mycobacterium bovis BCG (143 aa), FASTA scores: opt: 200,E(): 1.5e-06, (61.4% identity in 57 aa overlap); and Q00298|CUTI_BOTCI|CUTA CUTINASE PRECURSOR from Botrytis cinerea (Botryotinia fuckeliana) (202 aa), FASTA scores: opt: 108, E(): 2.2, (40.4% identity in 52 aa overlap). Also highly similar to others from Mycobacterium tuberculosis e.g. O06318|CUT3_MYCTU|Rv3451|MT3557|MTCY13E12.04 PROBABLE CUTINASE PRECURSOR (247 aa), FASTA scores: opt: 189, E(): 1.2e-05, (58.0% identity in 50 aa overlap); Q50664|CUT2_MYCTU|Rv2301|MT2358|MTCY339.08c PROBABLE CUTINASE PRECURSOR (219 aa), FASTA scores: opt: 172, E(): 0.00015, (59.2% identity in 49 aa overlap); O06793|Rv1758|MTCY28.24|Z95890 HYPOTHETICAL 17.9 KDA PROTEIN (174 aa), FASTA scores: opt: 641, E(): 2.7e-29,(57.2% identity in 166 aa overlap); O06319|Rv3452|MTY13E12.05; and U00015_11 from Mycobaterium leprae. BELONGS TO THE CUTINASE FAMILY. Rest of cutinase ORF continues as Rv3724B|CUT5B, frameshifting could occur near position 4169668. Sequence has been checked but no errors found. Probable cut5b, truncated cutinase (EC 3.1.1.-), similar to C-terminal end of others e.g. Q9XB09|RVD2-RV1758 PROTEIN (FRAGMENT) from Mycobacterium bovis BCG (143 aa) FASTA scores: opt: 335, E(): 3.4e-12,(53.25% identity in 92 aa overlap); Q9KK87 SERINE ESTERASE CUTINASE from Mycobacterium avium (220 aa), FASTA scores: opt: 251, E(): 2.5e-07, (44.05% identity in 168 aa overlap). Also similar to proteins from Mycobacterium tuberculosis e.g. O06793|Rv1758|MTCY28.24 HYPOTHETICAL 17.9 KDA PROTEIN (174 aa), FASTA scores: opt: 641, E(): 2.5e-29, (57.25% identity in 166 aa overlap); O06319|Rv3452|MTCY13E12.05 HYPOTHETICAL 23.1 KDA PROTEIN (226 aa), FASTA scores: opt: 385, E(): 7.5e-15, (46.65% identity in 165 aa overlap); O06318|CUT3_MYCTU|Rv3451|MT3557|MTCY13E12.04 PROBABLE CUTINASE PRECURSOR (247 aa), FASTA scores: opt: 307, E(): 1.9e-10, (40.7% identity in 167 aa overlap); Q10837|CUT1_MYCTU|Rv1984c|MT2037|MTCY39.35 PROBABLE CUTINASE PRECURSOR (217 aa), FASTA scores: opt: 261, E(): 6.7e-08, (50.9% identity in 169 aa overlap); etc; and U00015_11 from Mycobacterium lepra. 5'-end of gene is Rv3724A|CUT5A; frameshifting may occur near position 4169668. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis, Rv3724A and Rv3724B exist as 2 genes with an overlap region between them. In Mycobacterium bovis, a single base deletion (t-*) leads to a single product.
Functional categoryCell wall and cell processes
Mutant
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41069274107628+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium bovis AF2122-97|Mb3751|cut5
MDVIRWARRLAVVAGTAAAVTTPGLLSAHVPMVSAEPCPDVEVVFARGTGEPPGIGSVGGLFVDALRSQVGAKSLGVYAVNYPASNDFASSDFPKTVIDGIRDAGSHIQSMAMSCPQTRQVLGGYSQGAAVAGYVTSAVVPPAVPVQAVPAPMAPEVANHVAAVTLFGAPSAQFLGQYGAPPIAIGPLYQPKTLQLCADGDSICGDGNSPVAHGLYAVNGMVGQGANFAASRL
      
Bibliography
No article yet recorded