Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionHydrolysis of cutin (a polyester that forms the structure of plant cuticle).
ProductProbable cutinase precursor [first part] Cut5a
CommentsRv3724A, (MTV025.072), len: 80 aa. Probable cut5a, truncated cutinase precursor, similar to N-terminal end of others e.g. Q9KK87 serine esterase cutinase from Mycobacterium avium (220 aa), FASTA scores: opt: 202, E(): 1.5e-06, (56.45% identity in 62 aa overlap); Q9XB09|RVD2-RV1758 protein (fragment) from Mycobacterium bovis BCG (143 aa), FASTA scores: opt: 200, E(): 1.5e-06, (61.4% identity in 57 aa overlap); and Q00298|CUTI_BOTCI|CUTA cutinase precursor from Botrytis cinerea (Botryotinia fuckeliana) (202 aa), FASTA scores: opt: 108, E(): 2.2, (40.4% identity in 52 aa overlap). Also highly similar to others from Mycobacterium tuberculosis e.g. O06318|CUT3_MYCTU|Rv3451|MT3557|MTCY13E12.04 probable cutinase precursor (247 aa), FASTA scores: opt: 189, E(): 1.2e-05, (58.0% identity in 50 aa overlap); Q50664|CUT2_MYCTU|Rv2301|MT2358|MTCY339.08c probable cutinase precursor (219 aa), FASTA scores: opt: 172, E(): 0.00015, (59.2% identity in 49 aa overlap); O06793|Rv1758|MTCY28.24|Z95890 hypothetical 17.9 KDA protein (174 aa), FASTA scores: opt: 641, E(): 2.7e-29, (57.2% identity in 166 aa overlap); O06319|Rv3452|MTY13E12.05; and U00015_11 from Mycobacterium leprae. Belongs to the cutinase family. Rest of cutinase ORF continues as Rv3724B|CUT5B, frameshifting could occur near position 4169668. Sequence has been checked but no errors found.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41694674169709+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3724A|cut5a
MDVIRWARRLAVVAGTAAAVTTPGLLSAHVPMVSAEPCPDVEVVFARGTGEPPGIGSVGGLFVDALRFPGWRQVTRGLRR