Gene Rv3724B (culp7, clp7)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolysis of cutin (a polyester that forms the structure of plant cuticle). |
| Product | Probable cutinase [second part] Cut5b |
| Comments | Rv3724B, (MTV025.072), len: 187 aa. Probable cut5b, truncated cutinase, similar to C-terminal end of others e.g. Q9XB09|RVD2-RV1758 protein (fragment) from Mycobacterium bovis BCG (143 aa) FASTA scores: opt: 335, E(): 3.4e-12, (53.25% identity in 92 aa overlap); Q9KK87 serine esterase cutinase from Mycobacterium avium (220 aa), FASTA scores: opt: 251, E(): 2.5e-07, (44.05% identity in 168 aa overlap). Also similar to proteins from Mycobacterium tuberculosis e.g. O06793|Rv1758|MTCY28.24 hypothetical 17.9 KDA protein (174 aa), FASTA scores: opt: 641, E(): 2.5e-29, (57.25% identity in 166 aa overlap); O06319|Rv3452|MTCY13E12.05 hypothetical 23.1 KDA protein (226 aa), FASTA scores: opt: 385, E(): 7.5e-15, (46.65% identity in 165 aa overlap); O06318|CUT3_MYCTU|Rv3451|MT3557|MTCY13E12.04 probable cutinase precursor (247 aa), FASTA scores: opt: 307, E(): 1.9e-10, (40.7% identity in 167 aa overlap); Q10837|CUT1_MYCTU|Rv1984c|MT2037|MTCY39.35 probable cutinase precursor (217 aa), FASTA scores: opt: 261, E(): 6.7e-08, (50.9% identity in 169 aa overlap); etc; and U00015_11 from Mycobacterium lepra. 5'-end of gene is Rv3724A|CUT5A; frameshifting may occur near position 4169668. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4169606 | 4170169 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3724B|cut5b
VAPGSHLVLAASEDCSSTHCVSQVGAKSLGVYAVNYPASNDFASSDFPKTVIDGIRDAGSHIQSMAMSCPQTRQVLGGYSQGAAVAGYVTSAVVPPAVPVQAVPAPMAPEVANHVAAVTLFGAPSAQFLGQYGAPPIAIGPLYQPKTLQLCADGDSICGDGNSPVAHGLYAVNGMVGQGANFAASRL
Bibliography
- West NP, Chow FM, Randall EJ, Wu J, Chen J, Ribeiro JM and Britton WJ [2009]. Cutinase-like proteins of Mycobacterium tuberculosis: characterization of their variable enzymatic functions and active site identification. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant