Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThis protein seals during DNA replication, DNA recombination and DNA repair NICKS in double-stranded DNA [catalytic activity: ATP + (deoxyribonucleotide)(N) + (deoxyribonucleotide)(M) = AMP + pyrophosphate + (deoxyribonucleotide)(N+M)].
ProductPossible ATP-dependent DNA ligase LigC (polydeoxyribonucleotide synthase [ATP]) (polynucleotide ligase [ATP]) (sealase) (DNA repair protein) (DNA joinase)
CommentsRv3731, (MTV025.079), len: 358 aa. Possible ligC, DNA ligase ATP-dependent (see citation below), similar to numerous archaebacterial and eukaryotic polynucleotide DNA ligases e.g. Q9XAM3|SC4C6.17c from Streptomyces coelicolor (355 aa), FASTA scores: opt: 1429, E(): 1.7e-82, (60.4% identity in 361 aa overlap); BAB54870|MLL9685 from Rhizobium loti (Mesorhizobium loti) plasmid pMLb (337 aa), FASTA scores: opt: 667, E(): 1.2e-34, (40.35% identity in 347 aa overlap); Q9HH07|DNLI_THEFM|LIG from Thermococcus fumicolans (559 aa), FASTA scores: opt: 335, E(): 1.4e-13, (27.25% identity in 330 aa overlap); O59288|DNLI_PYRHO from Pyrococcus horikoshii (559 aa), FASTA scores: opt: 307, E(): 8e-12, (26.85% identity in 272 aa overlap); etc. Also similar to Rv3062|MTCY22D7_19c|LIGB probable DNA ligase from Mycobacterium tuberculosis (507 aa), FASTA score: (30.3% identity in 356 aa overlap). Seems to belong to the ATP-dependent DNA ligase family.
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene in M. tuberculosis Erdman (See Gong et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41817584182834+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3731|ligC
MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPELVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLLALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDGVIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASVGVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVPLRPERVVEVRYDRMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR