Gene Rv3731
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | This protein seals during DNA replication, DNA recombination and DNA repair NICKS in double-stranded DNA [catalytic activity: ATP + (deoxyribonucleotide)(N) + (deoxyribonucleotide)(M) = AMP + pyrophosphate + (deoxyribonucleotide)(N+M)]. |
| Product | Possible ATP-dependent DNA ligase LigC (polydeoxyribonucleotide synthase [ATP]) (polynucleotide ligase [ATP]) (sealase) (DNA repair protein) (DNA joinase) |
| Comments | Rv3731, (MTV025.079), len: 358 aa. Possible ligC, DNA ligase ATP-dependent (see citation below), similar to numerous archaebacterial and eukaryotic polynucleotide DNA ligases e.g. Q9XAM3|SC4C6.17c from Streptomyces coelicolor (355 aa), FASTA scores: opt: 1429, E(): 1.7e-82, (60.4% identity in 361 aa overlap); BAB54870|MLL9685 from Rhizobium loti (Mesorhizobium loti) plasmid pMLb (337 aa), FASTA scores: opt: 667, E(): 1.2e-34, (40.35% identity in 347 aa overlap); Q9HH07|DNLI_THEFM|LIG from Thermococcus fumicolans (559 aa), FASTA scores: opt: 335, E(): 1.4e-13, (27.25% identity in 330 aa overlap); O59288|DNLI_PYRHO from Pyrococcus horikoshii (559 aa), FASTA scores: opt: 307, E(): 8e-12, (26.85% identity in 272 aa overlap); etc. Also similar to Rv3062|MTCY22D7_19c|LIGB probable DNA ligase from Mycobacterium tuberculosis (507 aa), FASTA score: (30.3% identity in 356 aa overlap). Seems to belong to the ATP-dependent DNA ligase family. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Non essential gene in M. tuberculosis Erdman (See Gong et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4181758 | 4182834 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3731|ligC
MQLPVMPPVSPMLAKSVTAIPPDASYEPKWDGFRSICFRDGDQVELGSRNERPMTRYFPELVAAIRAELPHRCVIDGEIIIATDHGLDFEALQQRIHPAESRVRMLADRTPASFIAFDLLALGDDDYTGRPFSERRAALVDAVTGSGADADLSIHVTPATTDMATAQRWFSEFEGAGLDGVIAKPPHITYQPDKRVMFKIKHLRTADCVVAGYRVHKSGSDAIGSLLLGLYQEDGQLASVGVIGAFPMAERRRLLTELQPLVTSFDDHPWNWAAHVAGQRTPRKNEFSRWNVGKDLSFVPLRPERVVEVRYDRMEGARFRHTAQFNRWRPDRDPRSCSYAQLERPLTVSLSDIVPGLR
Bibliography
- Mizrahi V et al. [1998]. DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Secondary Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Gong C et al. [2004]. Biochemical and genetic analysis of the four DNA ligases of mycobacteria. Biochemistry Function Mutant
- Gong C et al. [2005]. Mechanism of nonhomologous end-joining in mycobacteria: a low-fidelity repair system driven by Ku, ligase D and ligase C. Function Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant