Gene Rv3739c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | PPE family protein PPE67 |
Comments | Rv3739c, (MTV025.087c), len: 77 aa. PPE67, Member of the Mycobacterium tuberculosis PE family, showing high homology with O53269|Rv3022c|MTV012.36c (82 aa) FASTA scores: opt: 398, E(): 1.2e-19, (74.0% identity in 77 aa overlap); and similar to the N-termini of other PPE proteins e.g. O53265|Rv3018c|MTV012.32c (434 aa) FASTA scores: opt: 398, E(): 4.8e-19, (74.0% identity in 77 aa overlap). ORF ends at the stop codon at position 97470, which is not present in similar ORFs: MTV012_32, or MTCY21B4_4. Sequence homology with MTV012_32, and MTCY21B4_4 continues in the downstream ORF MTV025.086c|Rv3738c|PPE66. Sequence was checked, but no errors were detected. A similar situation, but with a frameshift separating the ORFs, is found in MTV012_36/MTV012_35. Also ORF MTV025.87c shows similarity to MTV03 _14; MTCY6A4_1; MTV035_8; MTV037_17; MLCB2492_30; MTCY261_19; MTCY251_15; MTCY3A2_23; MTCY28_16; etc. |
Functional category | Pe/ppe |
Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4190284 | 4190517 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3739c|PPE67 MTAPIWFASPPEVHSALLSAGPGPASLQAAAAEWTSLSAEYASAAQELTAVLAAVQGGAWEGPSAEAYVAAHLPYLA
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant