Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPPE family protein PPE67
CommentsRv3739c, (MTV025.087c), len: 77 aa. PPE67, Member of the Mycobacterium tuberculosis PE family, showing high homology with O53269|Rv3022c|MTV012.36c (82 aa) FASTA scores: opt: 398, E(): 1.2e-19, (74.0% identity in 77 aa overlap); and similar to the N-termini of other PPE proteins e.g. O53265|Rv3018c|MTV012.32c (434 aa) FASTA scores: opt: 398, E(): 4.8e-19, (74.0% identity in 77 aa overlap). ORF ends at the stop codon at position 97470, which is not present in similar ORFs: MTV012_32, or MTCY21B4_4. Sequence homology with MTV012_32, and MTCY21B4_4 continues in the downstream ORF MTV025.086c|Rv3738c|PPE66. Sequence was checked, but no errors were detected. A similar situation, but with a frameshift separating the ORFs, is found in MTV012_36/MTV012_35. Also ORF MTV025.87c shows similarity to MTV03 _14; MTCY6A4_1; MTV035_8; MTV037_17; MLCB2492_30; MTCY261_19; MTCY251_15; MTCY3A2_23; MTCY28_16; etc.
Functional categoryPe/ppe
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41902844190517-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3739c|PPE67
MTAPIWFASPPEVHSALLSAGPGPASLQAAAAEWTSLSAEYASAAQELTAVLAAVQGGAWEGPSAEAYVAAHLPYLA