Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible oxidoreductase
CommentsRv3742c, (MTV025.090c), len: 131 aa. Possible oxidoreductase, probably combines with product of downstream ORF MTV025.090c to form a functional monooxygenase, highly similar to N-terminal end of various oxidoreductases e.g. Q9A588|CC2569 monooxygenase (flavin-binding family) from Caulobacter crescentus (498 aa), FASTA scores: opt: 170, E(): 0.00048, (47.55% identity in 103 aa overlap); Q9APW3 aromatic-ring hyroxylase from Pseudomonas aeruginosa (508 aa) FASTA scores: opt: 160, E(): 0.0022, (50.55% identity in 87 aa overlap); Q9RZT0|DRB0033 arylesterase/monoxygenase from Deinococcus radiodurans (833 aa), FASTA scores: opt: 153, E(): 0.0097, (45.45% identity in 88 aa overlap); etc. Also similar to C-terminal end of Mycobacterium tuberculosis proteins (generally monooxygenases) e.g. P96223|Rv3854c|MTCY01A6.14 hypothetical 55.3 KDA protein (489 aa), FASTA scores: opt: 140, E(): 0.044, (37.1% identity in 132 aa overlap); O53300|Rv3083|MTV013.04 monoxygenase (495 aa) FASTA scores: opt: 133, E(): 0.13, (43.05% identity in 79 aa overlap); O53762|Rv0565c|MTV039.03c putative monoxygenase (486 aa), FASTA scores: opt: 110, E(): 4.1, (42.85% identity in 77 aa overlap); etc. Note similarity to MTCY01A6.14 and MTV013.04 continue in downstream ORF (MTV025.089c) after a gap of ~100 aa.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41928504193245-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3742c|Rv3742c
VHSEQSASIEHVDVLIVGAGISGTGAAYYLKTMQPAKTFAIVEARYPAIRSDSDLHTFSYEFKPWQHEKATASADAIMVHRGRSLAGGDRTLRHRRTRHHELRMVIIGSGATAVTLVPAMAQTAGAVTMPK