Gene Rv3751
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Sequence integration. |
| Product | Probable integrase (fragment) |
| Comments | Rv3751, (MTV025.099), len: 71 aa. Probable integrase (fragment), similar to part of many e.g. Q48908 integrase (fragment) from Mycobacterium paratuberculosis (191 aa), FASTA scores: opt: 206, E(): 5.5e-08, (57.65% identity in 59 aa overlap); Q9ZWV7|int integrase from Corynephage 304L (395 aa), FASTA scores: opt: 156, E(): 0.00036, (45.75% identity in 59 aa overlap); Q9K722|BH3551 integrase (phage-related protein) from Bacillus halodurans (378 aa), FASTA scores: opt: 151, E(): 0.00079, (46.15% identity in 52 aa overlap); etc. Also similarity with various conjugative transposons. Also similar to Mycobacterium tuberculosis hypothetical proteins e.g. P71903|Rv2309c|MTCY3G12.25 (151 aa), FASTA scores: opt: 193, E(): 3.8e-07, (50.85% identity in 59 aa overlap); O53403|Rv1055|MTV017.08 (78 aa), FASTA scores: opt: 171, E(): 7.8e-06, (54.15% identity in 48 aa overlap); etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4198874 | 4199089 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3751|Rv3751
VKRAKVQQITPHDLRHTAASLAVSAGVNVLALQRILGHKSAKVTLDTYADLFDADLDAVAVTLGKDADQQT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
